SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566719505|ref|YP_008919827.1| from Alteromonas macleodii str. 'Aegean Sea MED64'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566719505|ref|YP_008919827.1|
Domain Number 1 Region: 150-554
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.22e-52
Family Cystathionine synthase-like 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|566719505|ref|YP_008919827.1|
Sequence length 605
Comment homocysteine synthase [Alteromonas macleodii str. 'Aegean Sea MED64']
Sequence
MQSENNYQNTVSTAVDVKNAKVLSPKRNTTKAETTEGLVEEQLSHFGIDASSEYGKALAN
TAHHLYGAHASVMQLWDITSNTLQGLDKEDRVAYFNAKKFLSFQIAKILDTLQNPFRATY
QSLSSGSGSQGHYPLFDNVTALFSATPVVVRTATYVYACTEWVDDAFQGKEFTHQIYSRL
LNPTNISLANAIVDMEAGPYAADYLAWNFNSGMAAIDACLSNVLSHGDVLIVSRNVYGGV
YQLLHDYFARRNRMDIQIAWFDGYDTQSFAKFMQQTKAEYADRLDNGANMHIYLESPCNP
HGYVLDVPGICELAHAQNALVMLDSTLATPVLHQPLQHKNKAARPDYVIHSYTKDLCGSG
ATTAGVVIGEGHRMFQPKGSSVNGVDWSETMFWDVYYIKGAFLDSEKAFDVLNGMKTLEQ
RMMTKVINTQVFTSFLNAHNQIRVNCHALPEHENAGLREKQHTHGWPCTLFTVDMAPANL
PRDVFVRFFDALEPAFSHQVSIGQNNTIVLCPALTSHSELSSDEQKKAGIELTTMRIAMG
TDNVKQLIAHFMLAAKHFIEPHAPGFCEKFMANADIDALYVSVSERVCSQHFSSKASMDS
LMKGA
Download sequence
Identical sequences gi|566719505|ref|YP_008919827.1| WP_024016840.1.48123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]