SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147676532|ref|YP_001210747.1| from Pelotomaculum thermopropionicum SI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147676532|ref|YP_001210747.1|
Domain Number 1 Region: 9-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.17e-57
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 2 Region: 337-460
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.44e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.035
Further Details:      
 
Domain Number 3 Region: 215-323
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 9.42e-19
Family MesJ substrate recognition domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147676532|ref|YP_001210747.1|
Sequence length 473
Comment ATPase [Pelotomaculum thermopropionicum SI]
Sequence
MSLLHKVRENICRHRMVERGCKVLVAVSGGPDSVALLHALYLLKEELEISLHVAHLNHMF
RGAESEAEALFVADMARRYGLPATVEARDVPAYQKQSGLSAQAAAREVRFRFFSEAAGKA
GASRVALAHHADDQAETILINFLRGAGITGLKGISPVREGFYIRPLLTVRRAEIERYCKE
MKLPYCRDSSNLKAVYTRNRVRLELIPLLEKEYNPALVPTLLRLGEICREEDAYLAEQAV
KAFQAVLREKVSGRVVLRLDAFKQMPPAIRRRVVQQAWRSLTGAEENLAFQHVEAVLDLI
QKGGTGSSVVLPGSVSAIRSYGTVELVEKMTGRAVPYYVYPLKVPGATFIPELGCTIYAE
LYPRVKAGDPASLPATEALLDFDKLPAQIFVRRRRAGDVFCPFGLTSEMKLKDFFIKQKV
PREERDRIPLVGTPDEIVWVGGVRTGEKWKVDQNTARVLHLRLVCNLEGEAGF
Download sequence
Identical sequences A5D5U6
gi|147676532|ref|YP_001210747.1| 370438.PTH_0197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]