SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147677048|ref|YP_001211263.1| from Pelotomaculum thermopropionicum SI

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147677048|ref|YP_001211263.1|
Domain Number - Region: 12-123
Classification Level Classification E-value
Superfamily AF1862-like 0.000445
Family Cas Cmr5-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147677048|ref|YP_001211263.1|
Sequence length 150
Comment hypothetical protein PTH_0713 [Pelotomaculum thermopropionicum SI]
Sequence
MSNSMAQANLDRLAAQHAQNIIRRLVDEDKDGNKRAEKELKKVASSADNTVTKALGVLQE
NGVYACFLYLKAKEKDNGDVVIKEMLKLLNSLGFEWGLPTNDKGEVDTRAEVVLKYVTEK
VTVDLERLLLAKETLEKMLIYARYGAKARG
Download sequence
Identical sequences A5D4C9
370438.PTH_0713 gi|147677048|ref|YP_001211263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]