SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147677987|ref|YP_001212202.1| from Pelotomaculum thermopropionicum SI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147677987|ref|YP_001212202.1|
Domain Number 1 Region: 32-214
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.15e-32
Family Isochorismatase-like hydrolases 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147677987|ref|YP_001212202.1|
Sequence length 223
Comment amidases related to nicotinamidase [Pelotomaculum thermopropionicum SI]
Sequence
MKCRKEAFLEKSLDTLSSICDIIDNLPRLKVDGFIPEKTVLVIVDMINAFAREGNLMSPR
VNELVSTVSGILKLCRKHGIGAIAFADCHAPESPEFDAYPKHALAGTSESEVVDEIKEIG
GYTLILKNSTNGFLEEGFQSWLRENPQVENFIVVGDCTDICVQQFATTLKADFNRRNRRV
RVIVPVNAVDTYDYEPHNGDLMHLMALFSMMGNGIELCKGLVE
Download sequence
Identical sequences A5D1R5
370438.PTH_1652 gi|147677987|ref|YP_001212202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]