SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147678259|ref|YP_001212474.1| from Pelotomaculum thermopropionicum SI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147678259|ref|YP_001212474.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily AF1862-like 5.1e-32
Family Cas Cmr5-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147678259|ref|YP_001212474.1|
Sequence length 128
Comment hypothetical protein PTH_1924 [Pelotomaculum thermopropionicum SI]
Sequence
MLTRNQEYAARIYQQVKQLADKEDKDKCKKYGSMSHRLPVLIRTAGLAQALAFVEARGDA
GGKKLLEDIAIVLDFKGKEALLESSRGAELPEYMLLTRKVLAALTWYKRFAQSVLSVESG
AAEEDGTK
Download sequence
Identical sequences A5D0Z0
gi|147678259|ref|YP_001212474.1| 370438.PTH_1924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]