SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147678284|ref|YP_001212499.1| from Pelotomaculum thermopropionicum SI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147678284|ref|YP_001212499.1|
Domain Number 1 Region: 69-262
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.59e-72
Family B3/B4 domain of PheRS, PheT 0.00000528
Further Details:      
 
Domain Number 2 Region: 334-556
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.53e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000645
Further Details:      
 
Domain Number 3 Region: 568-666
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.36e-28
Family Anticodon-binding domain of PheRS 0.0005
Further Details:      
 
Domain Number 4 Region: 271-342
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.49e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.001
Further Details:      
 
Domain Number 5 Region: 1-58
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000822
Family Anticodon-binding domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147678284|ref|YP_001212499.1|
Sequence length 667
Comment phenylalanyl-tRNA synthetase beta subunit [Pelotomaculum thermopropionicum SI]
Sequence
MILPPGTPLGKDVKEILGLDDFILELDLTPNRGDCLSVYGVAREVAALLGRPLRPVEPAY
PEMGESIEGQVRVDIEAADLCGRFVGRLIKNVRVGPSPLWMQQRLRFAGIRPISNIVDVT
NYVMLELGQPMHAFDYELLEGGHIIVRRAREGEKITTLDGVERQLAPGMLCITDPSGPVA
IAGVMGGQATEVTGKTASVLLESAFFNPISIRRTSKVLGLRSQASLRFEKGIDIGGCARA
SARAAQLIVEMGAGEAVCGAVDAYPAPVPEKKIALRPARVNYVLGVDIPKEEAGSILSRL
QFKVQDAGEELLVTVPTHRVDVSLEIDLIEEIARLHGYNQVPGTLPYGLSTHGIETREQL
FTARIRDLLAGSGLYEVVTYSFTHPRVFDNMNLPPDSPLRNAVRIQNPLSEEHSVMRTML
LPGLLEILAGNYSRRVQNGAVFEIGRVFHSRGEQRLPEERPVLAAAAAGRTQGNWNTAPR
EMDFYYLKGVLEKLFGSIGTKAVNFRPETSNPSFHPGRTALLEAGGLELGVLGELHPHVS
ERFELPEKVVAFEIDLINLLSVSGQPVRYSPLPRFPAVERDIAIIVRQGIPAADVFDTIR
KAGGDLLRSVHLFDIYCGEQVPRGFQSMAFSLKFLAGDRTLTDVEVSERIEVISRTLAGK
FGASLRS
Download sequence
Identical sequences A5D0U0
gi|147678284|ref|YP_001212499.1| 370438.PTH_1949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]