SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224990792|ref|YP_002645479.1| from Mycobacterium bovis BCG str. Tokyo 172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224990792|ref|YP_002645479.1|
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily DAK1/DegV-like 5.49e-66
Family DegV-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224990792|ref|YP_002645479.1|
Sequence length 280
Comment hypothetical protein JTY_2427 [Mycobacterium bovis BCG str. Tokyo 172]
Sequence
MTVVVVTDTSCRLPADLREQWSIRQVPLHILLDGLDLRDGVDEIPDDIHKRHATTAGATP
VELSAAYQRALADSGGDGVVAVHISSALSGTFRAAELTAAELGPAVRVIDSRSAAMGVGF
AALAAGRAAAAGDELDTVARAAAAAVSRIHAFVAVARLDNLRRSGRISGAKAWLGTALAL
KPLLSVDDGKLVLVQRVRTVSNATAVMIDRVCQLVGDRPAALAVHHVADPAAANDVAAAL
AERLPACEPAMVTAMGPVLALHVGAGAVGVCVDVGASPPA
Download sequence
Identical sequences A0A045K089 A0A083W423 A0A0H3LBQ2 A0A0H3M8L9 A0A0Y1CPN4 A0A109SPL4 A0A197J3J9 A0A1S1B846 A5U5B2 F8M1Z2 G0TPA0 I6Y989 M8D4W7 P67369 P9WP04 P9WP05
gi|121638298|ref|YP_978522.1| gi|433635499|ref|YP_007269126.1| gi|148823620|ref|YP_001288374.1| gi|15609554|ref|NP_216933.1| gi|148662251|ref|YP_001283774.1| gi|339632444|ref|YP_004724086.1| gi|449064483|ref|YP_007431566.1| gi|383308199|ref|YP_005361010.1| NP_216933.1.84033 WP_003412381.1.100000 WP_003412381.1.100021 WP_003412381.1.100069 WP_003412381.1.100087 WP_003412381.1.10015 WP_003412381.1.100208 WP_003412381.1.100216 WP_003412381.1.10022 WP_003412381.1.100255 WP_003412381.1.100260 WP_003412381.1.100270 WP_003412381.1.100279 WP_003412381.1.100286 WP_003412381.1.100308 WP_003412381.1.100309 WP_003412381.1.100318 WP_003412381.1.100337 WP_003412381.1.100338 WP_003412381.1.10037 WP_003412381.1.100383 WP_003412381.1.100395 WP_003412381.1.100396 WP_003412381.1.1004 WP_003412381.1.100459 WP_003412381.1.100460 WP_003412381.1.100552 WP_003412381.1.100581 WP_003412381.1.100600 WP_003412381.1.100625 WP_003412381.1.10064 WP_003412381.1.100666 WP_003412381.1.100671 WP_003412381.1.100677 WP_003412381.1.100682 WP_003412381.1.100697 WP_003412381.1.100703 WP_003412381.1.100716 WP_003412381.1.100722 WP_003412381.1.100754 WP_003412381.1.100757 WP_003412381.1.100772 WP_003412381.1.1008 WP_003412381.1.100812 WP_003412381.1.100845 WP_003412381.1.100866 WP_003412381.1.10088 WP_003412381.1.100889 WP_003412381.1.10090 WP_003412381.1.100910 WP_003412381.1.100915 WP_003412381.1.100918 WP_003412381.1.100935 WP_003412381.1.100984 WP_003412381.1.100998 WP_003412381.1.101025 WP_003412381.1.101028 WP_003412381.1.10104 WP_003412381.1.101048 WP_003412381.1.101054 WP_003412381.1.101075 WP_003412381.1.101143 WP_003412381.1.101146 WP_003412381.1.10116 WP_003412381.1.10117 WP_003412381.1.101209 WP_003412381.1.10125 WP_003412381.1.101290 WP_003412381.1.101323 WP_003412381.1.101324 WP_003412381.1.101350 WP_003412381.1.101367 WP_003412381.1.101398 WP_003412381.1.101403 WP_003412381.1.101421 WP_003412381.1.10144 WP_003412381.1.101442 WP_003412381.1.10145 WP_003412381.1.101452 WP_003412381.1.101456 WP_003412381.1.101481 WP_003412381.1.101493 WP_003412381.1.101496 WP_003412381.1.101525 WP_003412381.1.101533 WP_003412381.1.101535 WP_003412381.1.101553 WP_003412381.1.101558 WP_003412381.1.10156 WP_003412381.1.101573 WP_003412381.1.10159 WP_003412381.1.101592 WP_003412381.1.101604 WP_003412381.1.101607 WP_003412381.1.101622 WP_003412381.1.101644 WP_003412381.1.101671 WP_003412381.1.101687 WP_003412381.1.101698 WP_003412381.1.10170 WP_003412381.1.101713 WP_003412381.1.101743 WP_003412381.1.101753 WP_003412381.1.101754 WP_003412381.1.101764 WP_003412381.1.101795 WP_003412381.1.101797 WP_003412381.1.101798 WP_003412381.1.101802 WP_003412381.1.101826 WP_003412381.1.101836 WP_003412381.1.101858 WP_003412381.1.101859 WP_003412381.1.101888 WP_003412381.1.101894 WP_003412381.1.101899 WP_003412381.1.1019 WP_003412381.1.101923 WP_003412381.1.101925 WP_003412381.1.10193 WP_003412381.1.101996 WP_003412381.1.102 WP_003412381.1.102008 WP_003412381.1.102017 WP_003412381.1.102053 WP_003412381.1.102055 WP_003412381.1.102063 WP_003412381.1.102099 WP_003412381.1.1021 WP_003412381.1.10211 WP_003412381.1.102121 WP_003412381.1.102143 WP_003412381.1.10216 WP_003412381.1.10224 WP_003412381.1.10253 WP_003412381.1.10262 WP_003412381.1.10272 WP_003412381.1.10277 WP_003412381.1.1033 WP_003412381.1.10350 WP_003412381.1.10362 WP_003412381.1.10366 WP_003412381.1.10376 WP_003412381.1.10396 WP_003412381.1.10410 WP_003412381.1.10414 WP_003412381.1.10421 WP_003412381.1.10430 WP_003412381.1.1044 WP_003412381.1.10440 WP_003412381.1.10471 WP_003412381.1.10472 WP_003412381.1.10489 WP_003412381.1.105 WP_003412381.1.10518 WP_003412381.1.10545 WP_003412381.1.1057 WP_003412381.1.10594 WP_003412381.1.10603 WP_003412381.1.10606 WP_003412381.1.10615 WP_003412381.1.10623 WP_003412381.1.10635 WP_003412381.1.10643 WP_003412381.1.10648 WP_003412381.1.10662 WP_003412381.1.10709 WP_003412381.1.10735 WP_003412381.1.10740 WP_003412381.1.10756 WP_003412381.1.1078 WP_003412381.1.10791 WP_003412381.1.10799 WP_003412381.1.10825 WP_003412381.1.10848 WP_003412381.1.10863 WP_003412381.1.10879 WP_003412381.1.10912 WP_003412381.1.10916 WP_003412381.1.10923 WP_003412381.1.10927 WP_003412381.1.1095 WP_003412381.1.10956 WP_003412381.1.10958 WP_003412381.1.10962 WP_003412381.1.10980 WP_003412381.1.10981 WP_003412381.1.10993 WP_003412381.1.1100 WP_003412381.1.11040 WP_003412381.1.11061 WP_003412381.1.11070 WP_003412381.1.11141 WP_003412381.1.11171 WP_003412381.1.11175 WP_003412381.1.11176 WP_003412381.1.11222 WP_003412381.1.11236 WP_003412381.1.11329 WP_003412381.1.1133 WP_003412381.1.11342 WP_003412381.1.11373 WP_003412381.1.11376 WP_003412381.1.11390 WP_003412381.1.11402 WP_003412381.1.11481 WP_003412381.1.11487 WP_003412381.1.11489 WP_003412381.1.11491 WP_003412381.1.11514 WP_003412381.1.11587 WP_003412381.1.11589 WP_003412381.1.11596 WP_003412381.1.11604 WP_003412381.1.11610 WP_003412381.1.11697 WP_003412381.1.11707 WP_003412381.1.11752 WP_003412381.1.11758 WP_003412381.1.11761 WP_003412381.1.11775 WP_003412381.1.11822 WP_003412381.1.11856 WP_003412381.1.11898 WP_003412381.1.11906 WP_003412381.1.11939 WP_003412381.1.11960 WP_003412381.1.11961 WP_003412381.1.11972 WP_003412381.1.11984 WP_003412381.1.120 WP_003412381.1.12001 WP_003412381.1.12049 WP_003412381.1.12052 WP_003412381.1.12100 WP_003412381.1.12116 WP_003412381.1.12130 WP_003412381.1.12133 WP_003412381.1.12161 WP_003412381.1.12165 WP_003412381.1.12184 WP_003412381.1.12187 WP_003412381.1.12190 WP_003412381.1.12216 WP_003412381.1.12265 WP_003412381.1.12275 WP_003412381.1.12293 WP_003412381.1.12294 WP_003412381.1.123 WP_003412381.1.1231 WP_003412381.1.12314 WP_003412381.1.12327 WP_003412381.1.12338 WP_003412381.1.1236 WP_003412381.1.12371 WP_003412381.1.12372 WP_003412381.1.12389 WP_003412381.1.12406 WP_003412381.1.1241 WP_003412381.1.12421 WP_003412381.1.12424 WP_003412381.1.12464 WP_003412381.1.12479 WP_003412381.1.12519 WP_003412381.1.12523 WP_003412381.1.12526 WP_003412381.1.1255 WP_003412381.1.12550 WP_003412381.1.12551 WP_003412381.1.12563 WP_003412381.1.12611 WP_003412381.1.12669 WP_003412381.1.1267 WP_003412381.1.12692 WP_003412381.1.1271 WP_003412381.1.12710 WP_003412381.1.12768 WP_003412381.1.1279 WP_003412381.1.12794 WP_003412381.1.12801 WP_003412381.1.12804 WP_003412381.1.12821 WP_003412381.1.12841 WP_003412381.1.12854 WP_003412381.1.12871 WP_003412381.1.12901 WP_003412381.1.12941 WP_003412381.1.12947 WP_003412381.1.12957 WP_003412381.1.12972 WP_003412381.1.13028 WP_003412381.1.13043 WP_003412381.1.13086 WP_003412381.1.13087 WP_003412381.1.13090 WP_003412381.1.13096 WP_003412381.1.13163 WP_003412381.1.13175 WP_003412381.1.13183 WP_003412381.1.132 WP_003412381.1.13249 WP_003412381.1.13282 WP_003412381.1.13284 WP_003412381.1.13296 WP_003412381.1.13298 WP_003412381.1.13302 WP_003412381.1.13306 WP_003412381.1.13312 WP_003412381.1.13313 WP_003412381.1.13321 WP_003412381.1.13345 WP_003412381.1.13358 WP_003412381.1.13370 WP_003412381.1.1338 WP_003412381.1.13420 WP_003412381.1.13433 WP_003412381.1.13435 WP_003412381.1.13438 WP_003412381.1.13461 WP_003412381.1.13466 WP_003412381.1.13489 WP_003412381.1.13526 WP_003412381.1.13551 WP_003412381.1.13561 WP_003412381.1.13564 WP_003412381.1.13579 WP_003412381.1.13647 WP_003412381.1.13667 WP_003412381.1.13697 WP_003412381.1.13719 WP_003412381.1.13763 WP_003412381.1.1377 WP_003412381.1.13774 WP_003412381.1.13786 WP_003412381.1.13793 WP_003412381.1.13794 WP_003412381.1.13817 WP_003412381.1.13834 WP_003412381.1.13866 WP_003412381.1.13880 WP_003412381.1.13899 WP_003412381.1.13909 WP_003412381.1.13919 WP_003412381.1.13920 WP_003412381.1.13952 WP_003412381.1.13953 WP_003412381.1.13962 WP_003412381.1.1398 WP_003412381.1.13988 WP_003412381.1.14027 WP_003412381.1.14046 WP_003412381.1.14115 WP_003412381.1.1415 WP_003412381.1.14152 WP_003412381.1.14158 WP_003412381.1.14162 WP_003412381.1.14175 WP_003412381.1.14178 WP_003412381.1.14194 WP_003412381.1.14195 WP_003412381.1.14208 WP_003412381.1.14238 WP_003412381.1.14266 WP_003412381.1.14273 WP_003412381.1.14303 WP_003412381.1.14306 WP_003412381.1.14307 WP_003412381.1.14310 WP_003412381.1.14341 WP_003412381.1.14382 WP_003412381.1.14416 WP_003412381.1.14428 WP_003412381.1.14441 WP_003412381.1.14469 WP_003412381.1.14477 WP_003412381.1.14504 WP_003412381.1.14514 WP_003412381.1.1452 WP_003412381.1.14527 WP_003412381.1.1454 WP_003412381.1.14544 WP_003412381.1.14548 WP_003412381.1.14551 WP_003412381.1.14561 WP_003412381.1.14573 WP_003412381.1.1462 WP_003412381.1.14658 WP_003412381.1.14667 WP_003412381.1.14668 WP_003412381.1.14675 WP_003412381.1.14694 WP_003412381.1.14695 WP_003412381.1.14709 WP_003412381.1.14766 WP_003412381.1.14865 WP_003412381.1.14872 WP_003412381.1.14905 WP_003412381.1.14926 WP_003412381.1.14951 WP_003412381.1.14955 WP_003412381.1.15003 WP_003412381.1.15009 WP_003412381.1.15028 WP_003412381.1.15040 WP_003412381.1.15052 WP_003412381.1.15065 WP_003412381.1.15072 WP_003412381.1.15089 WP_003412381.1.1509 WP_003412381.1.15126 WP_003412381.1.15131 WP_003412381.1.15168 WP_003412381.1.15172 WP_003412381.1.15174 WP_003412381.1.15187 WP_003412381.1.15196 WP_003412381.1.15210 WP_003412381.1.15216 WP_003412381.1.15217 WP_003412381.1.1523 WP_003412381.1.15232 WP_003412381.1.15238 WP_003412381.1.15240 WP_003412381.1.15253 WP_003412381.1.15267 WP_003412381.1.1527 WP_003412381.1.15292 WP_003412381.1.15299 WP_003412381.1.15302 WP_003412381.1.15322 WP_003412381.1.1534 WP_003412381.1.15345 WP_003412381.1.15365 WP_003412381.1.15372 WP_003412381.1.15386 WP_003412381.1.15387 WP_003412381.1.15442 WP_003412381.1.15447 WP_003412381.1.15449 WP_003412381.1.15477 WP_003412381.1.15481 WP_003412381.1.15492 WP_003412381.1.15511 WP_003412381.1.15512 WP_003412381.1.15558 WP_003412381.1.15559 WP_003412381.1.15599 WP_003412381.1.1560 WP_003412381.1.15611 WP_003412381.1.1563 WP_003412381.1.15633 WP_003412381.1.15643 WP_003412381.1.15688 WP_003412381.1.15755 WP_003412381.1.15763 WP_003412381.1.15774 WP_003412381.1.1578 WP_003412381.1.15780 WP_003412381.1.15827 WP_003412381.1.15834 WP_003412381.1.15842 WP_003412381.1.15848 WP_003412381.1.15853 WP_003412381.1.15870 WP_003412381.1.15877 WP_003412381.1.15893 WP_003412381.1.15896 WP_003412381.1.15926 WP_003412381.1.15933 WP_003412381.1.15946 WP_003412381.1.15958 WP_003412381.1.15973 WP_003412381.1.15987 WP_003412381.1.15993 WP_003412381.1.16025 WP_003412381.1.16043 WP_003412381.1.16055 WP_003412381.1.16066 WP_003412381.1.16069 WP_003412381.1.16077 WP_003412381.1.16106 WP_003412381.1.16108 WP_003412381.1.16110 WP_003412381.1.16130 WP_003412381.1.16136 WP_003412381.1.16139 WP_003412381.1.16141 WP_003412381.1.16143 WP_003412381.1.1630 WP_003412381.1.16318 WP_003412381.1.1632 WP_003412381.1.16327 WP_003412381.1.16334 WP_003412381.1.16345 WP_003412381.1.16374 WP_003412381.1.16384 WP_003412381.1.16386 WP_003412381.1.164 WP_003412381.1.1642 WP_003412381.1.16421 WP_003412381.1.16426 WP_003412381.1.16431 WP_003412381.1.1644 WP_003412381.1.16442 WP_003412381.1.16448 WP_003412381.1.16451 WP_003412381.1.16476 WP_003412381.1.16480 WP_003412381.1.16494 WP_003412381.1.1652 WP_003412381.1.16549 WP_003412381.1.16560 WP_003412381.1.16598 WP_003412381.1.16609 WP_003412381.1.16619 WP_003412381.1.16620 WP_003412381.1.16622 WP_003412381.1.16637 WP_003412381.1.1669 WP_003412381.1.16707 WP_003412381.1.16724 WP_003412381.1.16731 WP_003412381.1.16743 WP_003412381.1.1683 WP_003412381.1.16837 WP_003412381.1.16852 WP_003412381.1.16937 WP_003412381.1.16940 WP_003412381.1.16950 WP_003412381.1.16959 WP_003412381.1.16968 WP_003412381.1.1697 WP_003412381.1.16973 WP_003412381.1.16977 WP_003412381.1.16987 WP_003412381.1.17005 WP_003412381.1.17006 WP_003412381.1.17010 WP_003412381.1.17015 WP_003412381.1.17019 WP_003412381.1.17039 WP_003412381.1.17041 WP_003412381.1.17052 WP_003412381.1.17057 WP_003412381.1.17062 WP_003412381.1.1707 WP_003412381.1.17094 WP_003412381.1.17130 WP_003412381.1.17138 WP_003412381.1.17147 WP_003412381.1.17167 WP_003412381.1.17224 WP_003412381.1.17251 WP_003412381.1.17288 WP_003412381.1.17304 WP_003412381.1.17314 WP_003412381.1.17345 WP_003412381.1.17381 WP_003412381.1.17391 WP_003412381.1.17412 WP_003412381.1.1743 WP_003412381.1.17440 WP_003412381.1.17477 WP_003412381.1.17483 WP_003412381.1.17505 WP_003412381.1.17527 WP_003412381.1.17540 WP_003412381.1.17553 WP_003412381.1.17558 WP_003412381.1.17599 WP_003412381.1.17635 WP_003412381.1.17655 WP_003412381.1.17679 WP_003412381.1.1768 WP_003412381.1.17687 WP_003412381.1.17700 WP_003412381.1.17710 WP_003412381.1.17713 WP_003412381.1.17722 WP_003412381.1.17746 WP_003412381.1.17788 WP_003412381.1.17803 WP_003412381.1.17816 WP_003412381.1.17821 WP_003412381.1.17830 WP_003412381.1.17868 WP_003412381.1.17878 WP_003412381.1.1792 WP_003412381.1.17923 WP_003412381.1.1795 WP_003412381.1.17955 WP_003412381.1.17973 WP_003412381.1.18009 WP_003412381.1.18013 WP_003412381.1.18033 WP_003412381.1.18057 WP_003412381.1.18065 WP_003412381.1.18070 WP_003412381.1.18116 WP_003412381.1.18120 WP_003412381.1.18126 WP_003412381.1.1817 WP_003412381.1.18170 WP_003412381.1.18206 WP_003412381.1.18216 WP_003412381.1.18240 WP_003412381.1.18297 WP_003412381.1.18306 WP_003412381.1.18364 WP_003412381.1.18399 WP_003412381.1.18411 WP_003412381.1.18444 WP_003412381.1.18467 WP_003412381.1.18476 WP_003412381.1.18522 WP_003412381.1.18580 WP_003412381.1.18582 WP_003412381.1.18587 WP_003412381.1.186 WP_003412381.1.18601 WP_003412381.1.18639 WP_003412381.1.18647 WP_003412381.1.1868 WP_003412381.1.18694 WP_003412381.1.18710 WP_003412381.1.18751 WP_003412381.1.18781 WP_003412381.1.18793 WP_003412381.1.18804 WP_003412381.1.18816 WP_003412381.1.18823 WP_003412381.1.18827 WP_003412381.1.18838 WP_003412381.1.18849 WP_003412381.1.18856 WP_003412381.1.18945 WP_003412381.1.1898 WP_003412381.1.19005 WP_003412381.1.19056 WP_003412381.1.19063 WP_003412381.1.19066 WP_003412381.1.19071 WP_003412381.1.19085 WP_003412381.1.19094 WP_003412381.1.19144 WP_003412381.1.19159 WP_003412381.1.19193 WP_003412381.1.19231 WP_003412381.1.19243 WP_003412381.1.19264 WP_003412381.1.19295 WP_003412381.1.19307 WP_003412381.1.19364 WP_003412381.1.19382 WP_003412381.1.19400 WP_003412381.1.19426 WP_003412381.1.19429 WP_003412381.1.19464 WP_003412381.1.19480 WP_003412381.1.19512 WP_003412381.1.19553 WP_003412381.1.19562 WP_003412381.1.19564 WP_003412381.1.19568 WP_003412381.1.19572 WP_003412381.1.19596 WP_003412381.1.19600 WP_003412381.1.19630 WP_003412381.1.19694 WP_003412381.1.1970 WP_003412381.1.19707 WP_003412381.1.19742 WP_003412381.1.19785 WP_003412381.1.19820 WP_003412381.1.19868 WP_003412381.1.19874 WP_003412381.1.19890 WP_003412381.1.19900 WP_003412381.1.19922 WP_003412381.1.19936 WP_003412381.1.19946 WP_003412381.1.19949 WP_003412381.1.19960 WP_003412381.1.19964 WP_003412381.1.20007 WP_003412381.1.20016 WP_003412381.1.20028 WP_003412381.1.2003 WP_003412381.1.20037 WP_003412381.1.20039 WP_003412381.1.20082 WP_003412381.1.20085 WP_003412381.1.20097 WP_003412381.1.20116 WP_003412381.1.20130 WP_003412381.1.20141 WP_003412381.1.20142 WP_003412381.1.20158 WP_003412381.1.20239 WP_003412381.1.20243 WP_003412381.1.20259 WP_003412381.1.20262 WP_003412381.1.20268 WP_003412381.1.20272 WP_003412381.1.20273 WP_003412381.1.20280 WP_003412381.1.20294 WP_003412381.1.20300 WP_003412381.1.20322 WP_003412381.1.2037 WP_003412381.1.20372 WP_003412381.1.20381 WP_003412381.1.204 WP_003412381.1.20427 WP_003412381.1.20457 WP_003412381.1.20459 WP_003412381.1.20460 WP_003412381.1.20542 WP_003412381.1.20578 WP_003412381.1.20608 WP_003412381.1.20624 WP_003412381.1.20628 WP_003412381.1.2066 WP_003412381.1.20707 WP_003412381.1.20722 WP_003412381.1.20729 WP_003412381.1.20742 WP_003412381.1.20751 WP_003412381.1.20776 WP_003412381.1.20843 WP_003412381.1.20850 WP_003412381.1.2086 WP_003412381.1.20868 WP_003412381.1.20876 WP_003412381.1.20897 WP_003412381.1.20898 WP_003412381.1.2090 WP_003412381.1.20911 WP_003412381.1.20916 WP_003412381.1.20921 WP_003412381.1.20926 WP_003412381.1.20927 WP_003412381.1.20951 WP_003412381.1.20970 WP_003412381.1.2104 WP_003412381.1.21070 WP_003412381.1.21127 WP_003412381.1.21135 WP_003412381.1.21173 WP_003412381.1.21187 WP_003412381.1.212 WP_003412381.1.2120 WP_003412381.1.21219 WP_003412381.1.2123 WP_003412381.1.21231 WP_003412381.1.21234 WP_003412381.1.2126 WP_003412381.1.21292 WP_003412381.1.21307 WP_003412381.1.2131 WP_003412381.1.21321 WP_003412381.1.21365 WP_003412381.1.2137 WP_003412381.1.21392 WP_003412381.1.21397 WP_003412381.1.21403 WP_003412381.1.21415 WP_003412381.1.21418 WP_003412381.1.21430 WP_003412381.1.21434 WP_003412381.1.21444 WP_003412381.1.21468 WP_003412381.1.21498 WP_003412381.1.21509 WP_003412381.1.21513 WP_003412381.1.21560 WP_003412381.1.21565 WP_003412381.1.21591 WP_003412381.1.21594 WP_003412381.1.21602 WP_003412381.1.21615 WP_003412381.1.21638 WP_003412381.1.21639 WP_003412381.1.21655 WP_003412381.1.21658 WP_003412381.1.2168 WP_003412381.1.2174 WP_003412381.1.21741 WP_003412381.1.21742 WP_003412381.1.21777 WP_003412381.1.21786 WP_003412381.1.21795 WP_003412381.1.218 WP_003412381.1.21826 WP_003412381.1.21829 WP_003412381.1.21840 WP_003412381.1.21843 WP_003412381.1.21872 WP_003412381.1.2188 WP_003412381.1.21882 WP_003412381.1.21906 WP_003412381.1.21912 WP_003412381.1.2194 WP_003412381.1.21941 WP_003412381.1.21956 WP_003412381.1.21958 WP_003412381.1.21960 WP_003412381.1.21973 WP_003412381.1.21983 WP_003412381.1.22003 WP_003412381.1.22013 WP_003412381.1.22025 WP_003412381.1.22036 WP_003412381.1.22075 WP_003412381.1.22092 WP_003412381.1.2212 WP_003412381.1.22127 WP_003412381.1.22140 WP_003412381.1.22233 WP_003412381.1.22255 WP_003412381.1.22277 WP_003412381.1.22305 WP_003412381.1.22348 WP_003412381.1.22356 WP_003412381.1.22366 WP_003412381.1.2238 WP_003412381.1.22380 WP_003412381.1.22437 WP_003412381.1.22438 WP_003412381.1.22445 WP_003412381.1.22490 WP_003412381.1.22511 WP_003412381.1.22524 WP_003412381.1.22585 WP_003412381.1.22589 WP_003412381.1.22606 WP_003412381.1.22608 WP_003412381.1.22609 WP_003412381.1.22618 WP_003412381.1.2262 WP_003412381.1.22624 WP_003412381.1.22629 WP_003412381.1.22647 WP_003412381.1.22664 WP_003412381.1.22665 WP_003412381.1.22670 WP_003412381.1.22674 WP_003412381.1.22680 WP_003412381.1.22725 WP_003412381.1.22728 WP_003412381.1.22733 WP_003412381.1.22737 WP_003412381.1.2275 WP_003412381.1.22754 WP_003412381.1.22797 WP_003412381.1.22800 WP_003412381.1.22804 WP_003412381.1.22829 WP_003412381.1.22840 WP_003412381.1.22844 WP_003412381.1.22963 WP_003412381.1.22970 WP_003412381.1.22996 WP_003412381.1.22997 WP_003412381.1.22999 WP_003412381.1.23015 WP_003412381.1.23032 WP_003412381.1.231 WP_003412381.1.23101 WP_003412381.1.2312 WP_003412381.1.23140 WP_003412381.1.23153 WP_003412381.1.23171 WP_003412381.1.23199 WP_003412381.1.2320 WP_003412381.1.23204 WP_003412381.1.23216 WP_003412381.1.23229 WP_003412381.1.23233 WP_003412381.1.2326 WP_003412381.1.23261 WP_003412381.1.23272 WP_003412381.1.23289 WP_003412381.1.2329 WP_003412381.1.23308 WP_003412381.1.23316 WP_003412381.1.23321 WP_003412381.1.23325 WP_003412381.1.2339 WP_003412381.1.23406 WP_003412381.1.23438 WP_003412381.1.23445 WP_003412381.1.23447 WP_003412381.1.23452 WP_003412381.1.23461 WP_003412381.1.2349 WP_003412381.1.23496 WP_003412381.1.23497 WP_003412381.1.23506 WP_003412381.1.23530 WP_003412381.1.23539 WP_003412381.1.23546 WP_003412381.1.23551 WP_003412381.1.23573 WP_003412381.1.23583 WP_003412381.1.23588 WP_003412381.1.23628 WP_003412381.1.23677 WP_003412381.1.23683 WP_003412381.1.23692 WP_003412381.1.23694 WP_003412381.1.23699 WP_003412381.1.2371 WP_003412381.1.23807 WP_003412381.1.23825 WP_003412381.1.23832 WP_003412381.1.2384 WP_003412381.1.23843 WP_003412381.1.23863 WP_003412381.1.2387 WP_003412381.1.23894 WP_003412381.1.23993 WP_003412381.1.2400 WP_003412381.1.24007 WP_003412381.1.24008 WP_003412381.1.24046 WP_003412381.1.24057 WP_003412381.1.24062 WP_003412381.1.24113 WP_003412381.1.24119 WP_003412381.1.24128 WP_003412381.1.24140 WP_003412381.1.24176 WP_003412381.1.24190 WP_003412381.1.24202 WP_003412381.1.24244 WP_003412381.1.24261 WP_003412381.1.24284 WP_003412381.1.24294 WP_003412381.1.24357 WP_003412381.1.24396 WP_003412381.1.24414 WP_003412381.1.24423 WP_003412381.1.2443 WP_003412381.1.24446 WP_003412381.1.24461 WP_003412381.1.24500 WP_003412381.1.24507 WP_003412381.1.24509 WP_003412381.1.24529 WP_003412381.1.24553 WP_003412381.1.24599 WP_003412381.1.24629 WP_003412381.1.24638 WP_003412381.1.2466 WP_003412381.1.24767 WP_003412381.1.24824 WP_003412381.1.24831 WP_003412381.1.24840 WP_003412381.1.24848 WP_003412381.1.24857 WP_003412381.1.2487 WP_003412381.1.24893 WP_003412381.1.24907 WP_003412381.1.24933 WP_003412381.1.24956 WP_003412381.1.24958 WP_003412381.1.2499 WP_003412381.1.25004 WP_003412381.1.2505 WP_003412381.1.25051 WP_003412381.1.2507 WP_003412381.1.25103 WP_003412381.1.25129 WP_003412381.1.25171 WP_003412381.1.25184 WP_003412381.1.25247 WP_003412381.1.25252 WP_003412381.1.25278 WP_003412381.1.25283 WP_003412381.1.25309 WP_003412381.1.25313 WP_003412381.1.25338 WP_003412381.1.25342 WP_003412381.1.25343 WP_003412381.1.25367 WP_003412381.1.25393 WP_003412381.1.25406 WP_003412381.1.25435 WP_003412381.1.25437 WP_003412381.1.25445 WP_003412381.1.25455 WP_003412381.1.25473 WP_003412381.1.25504 WP_003412381.1.25513 WP_003412381.1.25542 WP_003412381.1.25579 WP_003412381.1.25594 WP_003412381.1.25606 WP_003412381.1.25645 WP_003412381.1.2566 WP_003412381.1.25673 WP_003412381.1.25674 WP_003412381.1.25693 WP_003412381.1.25699 WP_003412381.1.25727 WP_003412381.1.25736 WP_003412381.1.25738 WP_003412381.1.25756 WP_003412381.1.25759 WP_003412381.1.2580 WP_003412381.1.25813 WP_003412381.1.25853 WP_003412381.1.25854 WP_003412381.1.25874 WP_003412381.1.25885 WP_003412381.1.25892 WP_003412381.1.25906 WP_003412381.1.25914 WP_003412381.1.2594 WP_003412381.1.25954 WP_003412381.1.25965 WP_003412381.1.25972 WP_003412381.1.26017 WP_003412381.1.26032 WP_003412381.1.26038 WP_003412381.1.26072 WP_003412381.1.26089 WP_003412381.1.26097 WP_003412381.1.26098 WP_003412381.1.26108 WP_003412381.1.26109 WP_003412381.1.26118 WP_003412381.1.26126 WP_003412381.1.2614 WP_003412381.1.26168 WP_003412381.1.26182 WP_003412381.1.26190 WP_003412381.1.2620 WP_003412381.1.26234 WP_003412381.1.26243 WP_003412381.1.26265 WP_003412381.1.26267 WP_003412381.1.26292 WP_003412381.1.26310 WP_003412381.1.26328 WP_003412381.1.26349 WP_003412381.1.26366 WP_003412381.1.26374 WP_003412381.1.26407 WP_003412381.1.26412 WP_003412381.1.26454 WP_003412381.1.26464 WP_003412381.1.2653 WP_003412381.1.26560 WP_003412381.1.26571 WP_003412381.1.2659 WP_003412381.1.26597 WP_003412381.1.26603 WP_003412381.1.26629 WP_003412381.1.26651 WP_003412381.1.26702 WP_003412381.1.26707 WP_003412381.1.26710 WP_003412381.1.26737 WP_003412381.1.26738 WP_003412381.1.26745 WP_003412381.1.26756 WP_003412381.1.2676 WP_003412381.1.2677 WP_003412381.1.26779 WP_003412381.1.26780 WP_003412381.1.26798 WP_003412381.1.26854 WP_003412381.1.26868 WP_003412381.1.26876 WP_003412381.1.26888 WP_003412381.1.26945 WP_003412381.1.26959 WP_003412381.1.26969 WP_003412381.1.26984 WP_003412381.1.26992 WP_003412381.1.27004 WP_003412381.1.27017 WP_003412381.1.27045 WP_003412381.1.27074 WP_003412381.1.27075 WP_003412381.1.27128 WP_003412381.1.27130 WP_003412381.1.27139 WP_003412381.1.27152 WP_003412381.1.27162 WP_003412381.1.27164 WP_003412381.1.27193 WP_003412381.1.27235 WP_003412381.1.27254 WP_003412381.1.27278 WP_003412381.1.27343 WP_003412381.1.27352 WP_003412381.1.27369 WP_003412381.1.27391 WP_003412381.1.27398 WP_003412381.1.27402 WP_003412381.1.27410 WP_003412381.1.27411 WP_003412381.1.27449 WP_003412381.1.27460 WP_003412381.1.27463 WP_003412381.1.2749 WP_003412381.1.27492 WP_003412381.1.27528 WP_003412381.1.27541 WP_003412381.1.27576 WP_003412381.1.27582 WP_003412381.1.27596 WP_003412381.1.27607 WP_003412381.1.2766 WP_003412381.1.277 WP_003412381.1.27724 WP_003412381.1.27730 WP_003412381.1.27736 WP_003412381.1.27743 WP_003412381.1.27750 WP_003412381.1.27771 WP_003412381.1.27779 WP_003412381.1.27795 WP_003412381.1.27803 WP_003412381.1.27819 WP_003412381.1.27835 WP_003412381.1.27915 WP_003412381.1.27935 WP_003412381.1.27962 WP_003412381.1.28053 WP_003412381.1.28092 WP_003412381.1.28131 WP_003412381.1.28142 WP_003412381.1.28159 WP_003412381.1.2816 WP_003412381.1.28161 WP_003412381.1.28192 WP_003412381.1.28202 WP_003412381.1.28241 WP_003412381.1.28255 WP_003412381.1.28269 WP_003412381.1.28276 WP_003412381.1.28293 WP_003412381.1.28331 WP_003412381.1.28367 WP_003412381.1.28378 WP_003412381.1.28391 WP_003412381.1.2842 WP_003412381.1.28448 WP_003412381.1.2847 WP_003412381.1.28471 WP_003412381.1.28473 WP_003412381.1.28493 WP_003412381.1.28497 WP_003412381.1.28530 WP_003412381.1.28545 WP_003412381.1.28561 WP_003412381.1.28567 WP_003412381.1.28585 WP_003412381.1.286 WP_003412381.1.28610 WP_003412381.1.28617 WP_003412381.1.28634 WP_003412381.1.28642 WP_003412381.1.28671 WP_003412381.1.28682 WP_003412381.1.28698 WP_003412381.1.28703 WP_003412381.1.28739 WP_003412381.1.28758 WP_003412381.1.28781 WP_003412381.1.28787 WP_003412381.1.28827 WP_003412381.1.28839 WP_003412381.1.28847 WP_003412381.1.28851 WP_003412381.1.28865 WP_003412381.1.28897 WP_003412381.1.28914 WP_003412381.1.28935 WP_003412381.1.28936 WP_003412381.1.28939 WP_003412381.1.28943 WP_003412381.1.28952 WP_003412381.1.28975 WP_003412381.1.2899 WP_003412381.1.28993 WP_003412381.1.29000 WP_003412381.1.2901 WP_003412381.1.29028 WP_003412381.1.29033 WP_003412381.1.29058 WP_003412381.1.29078 WP_003412381.1.29102 WP_003412381.1.29115 WP_003412381.1.2916 WP_003412381.1.29217 WP_003412381.1.29223 WP_003412381.1.29234 WP_003412381.1.29264 WP_003412381.1.29275 WP_003412381.1.29306 WP_003412381.1.29339 WP_003412381.1.29364 WP_003412381.1.29367 WP_003412381.1.29399 WP_003412381.1.2944 WP_003412381.1.29449 WP_003412381.1.29450 WP_003412381.1.29452 WP_003412381.1.2949 WP_003412381.1.29510 WP_003412381.1.29515 WP_003412381.1.29525 WP_003412381.1.2953 WP_003412381.1.29559 WP_003412381.1.29587 WP_003412381.1.2959 WP_003412381.1.29592 WP_003412381.1.29599 WP_003412381.1.29611 WP_003412381.1.29632 WP_003412381.1.29649 WP_003412381.1.2965 WP_003412381.1.29659 WP_003412381.1.2969 WP_003412381.1.29698 WP_003412381.1.29718 WP_003412381.1.29742 WP_003412381.1.29745 WP_003412381.1.29769 WP_003412381.1.29825 WP_003412381.1.29830 WP_003412381.1.29847 WP_003412381.1.29861 WP_003412381.1.29869 WP_003412381.1.29883 WP_003412381.1.29890 WP_003412381.1.299 WP_003412381.1.29931 WP_003412381.1.29960 WP_003412381.1.30014 WP_003412381.1.3004 WP_003412381.1.30040 WP_003412381.1.30043 WP_003412381.1.30074 WP_003412381.1.30097 WP_003412381.1.30101 WP_003412381.1.30106 WP_003412381.1.30114 WP_003412381.1.30126 WP_003412381.1.30131 WP_003412381.1.30139 WP_003412381.1.30145 WP_003412381.1.30211 WP_003412381.1.30224 WP_003412381.1.30235 WP_003412381.1.30237 WP_003412381.1.3027 WP_003412381.1.30279 WP_003412381.1.30282 WP_003412381.1.30283 WP_003412381.1.30288 WP_003412381.1.30291 WP_003412381.1.30363 WP_003412381.1.30374 WP_003412381.1.30404 WP_003412381.1.3043 WP_003412381.1.30433 WP_003412381.1.30438 WP_003412381.1.30464 WP_003412381.1.30468 WP_003412381.1.30500 WP_003412381.1.3057 WP_003412381.1.30574 WP_003412381.1.30628 WP_003412381.1.30641 WP_003412381.1.30642 WP_003412381.1.30661 WP_003412381.1.30669 WP_003412381.1.30683 WP_003412381.1.30699 WP_003412381.1.30709 WP_003412381.1.30713 WP_003412381.1.30716 WP_003412381.1.30719 WP_003412381.1.30730 WP_003412381.1.30732 WP_003412381.1.30736 WP_003412381.1.30745 WP_003412381.1.30760 WP_003412381.1.30791 WP_003412381.1.308 WP_003412381.1.30807 WP_003412381.1.30818 WP_003412381.1.30824 WP_003412381.1.30848 WP_003412381.1.30877 WP_003412381.1.30888 WP_003412381.1.30901 WP_003412381.1.30903 WP_003412381.1.30912 WP_003412381.1.30913 WP_003412381.1.30914 WP_003412381.1.30919 WP_003412381.1.30977 WP_003412381.1.3100 WP_003412381.1.31002 WP_003412381.1.3101 WP_003412381.1.31034 WP_003412381.1.31047 WP_003412381.1.31074 WP_003412381.1.31127 WP_003412381.1.31184 WP_003412381.1.31199 WP_003412381.1.31226 WP_003412381.1.31230 WP_003412381.1.31233 WP_003412381.1.31263 WP_003412381.1.31264 WP_003412381.1.31270 WP_003412381.1.31287 WP_003412381.1.31290 WP_003412381.1.31304 WP_003412381.1.31346 WP_003412381.1.31354 WP_003412381.1.31390 WP_003412381.1.31414 WP_003412381.1.31417 WP_003412381.1.3143 WP_003412381.1.31458 WP_003412381.1.31483 WP_003412381.1.3149 WP_003412381.1.31498 WP_003412381.1.31537 WP_003412381.1.31548 WP_003412381.1.31569 WP_003412381.1.316 WP_003412381.1.31629 WP_003412381.1.31666 WP_003412381.1.31693 WP_003412381.1.31703 WP_003412381.1.31744 WP_003412381.1.31745 WP_003412381.1.31770 WP_003412381.1.31776 WP_003412381.1.31783 WP_003412381.1.318 WP_003412381.1.3184 WP_003412381.1.31840 WP_003412381.1.31911 WP_003412381.1.31930 WP_003412381.1.31932 WP_003412381.1.31955 WP_003412381.1.31985 WP_003412381.1.31991 WP_003412381.1.31995 WP_003412381.1.32004 WP_003412381.1.3204 WP_003412381.1.32045 WP_003412381.1.32071 WP_003412381.1.32098 WP_003412381.1.32157 WP_003412381.1.32164 WP_003412381.1.32179 WP_003412381.1.32198 WP_003412381.1.32297 WP_003412381.1.32317 WP_003412381.1.32383 WP_003412381.1.32403 WP_003412381.1.32416 WP_003412381.1.32433 WP_003412381.1.32461 WP_003412381.1.32503 WP_003412381.1.32556 WP_003412381.1.32562 WP_003412381.1.32569 WP_003412381.1.32592 WP_003412381.1.32620 WP_003412381.1.32647 WP_003412381.1.32653 WP_003412381.1.32654 WP_003412381.1.3268 WP_003412381.1.32695 WP_003412381.1.32706 WP_003412381.1.32716 WP_003412381.1.32738 WP_003412381.1.32752 WP_003412381.1.32780 WP_003412381.1.32781 WP_003412381.1.32793 WP_003412381.1.32822 WP_003412381.1.32833 WP_003412381.1.32862 WP_003412381.1.32880 WP_003412381.1.32897 WP_003412381.1.32909 WP_003412381.1.32935 WP_003412381.1.32974 WP_003412381.1.33007 WP_003412381.1.3302 WP_003412381.1.33028 WP_003412381.1.33035 WP_003412381.1.33044 WP_003412381.1.33054 WP_003412381.1.33082 WP_003412381.1.33141 WP_003412381.1.33148 WP_003412381.1.33155 WP_003412381.1.33168 WP_003412381.1.3321 WP_003412381.1.33215 WP_003412381.1.3325 WP_003412381.1.3327 WP_003412381.1.33278 WP_003412381.1.33288 WP_003412381.1.33305 WP_003412381.1.3331 WP_003412381.1.33319 WP_003412381.1.3333 WP_003412381.1.33393 WP_003412381.1.33403 WP_003412381.1.33452 WP_003412381.1.33467 WP_003412381.1.33477 WP_003412381.1.3349 WP_003412381.1.33519 WP_003412381.1.33542 WP_003412381.1.33601 WP_003412381.1.33602 WP_003412381.1.33633 WP_003412381.1.33646 WP_003412381.1.33673 WP_003412381.1.3369 WP_003412381.1.33705 WP_003412381.1.33762 WP_003412381.1.33783 WP_003412381.1.33789 WP_003412381.1.3383 WP_003412381.1.33832 WP_003412381.1.33839 WP_003412381.1.3387 WP_003412381.1.33886 WP_003412381.1.33895 WP_003412381.1.33906 WP_003412381.1.33912 WP_003412381.1.33954 WP_003412381.1.3399 WP_003412381.1.34042 WP_003412381.1.3405 WP_003412381.1.34055 WP_003412381.1.34056 WP_003412381.1.34065 WP_003412381.1.34090 WP_003412381.1.34109 WP_003412381.1.34111 WP_003412381.1.34131 WP_003412381.1.34152 WP_003412381.1.34153 WP_003412381.1.34163 WP_003412381.1.34181 WP_003412381.1.34197 WP_003412381.1.34198 WP_003412381.1.34215 WP_003412381.1.34219 WP_003412381.1.34255 WP_003412381.1.34260 WP_003412381.1.34275 WP_003412381.1.343 WP_003412381.1.34347 WP_003412381.1.34358 WP_003412381.1.34392 WP_003412381.1.344 WP_003412381.1.34428 WP_003412381.1.3443 WP_003412381.1.34435 WP_003412381.1.34446 WP_003412381.1.34499 WP_003412381.1.34505 WP_003412381.1.34516 WP_003412381.1.34529 WP_003412381.1.34551 WP_003412381.1.34563 WP_003412381.1.34576 WP_003412381.1.34581 WP_003412381.1.34588 WP_003412381.1.34596 WP_003412381.1.34599 WP_003412381.1.34639 WP_003412381.1.34673 WP_003412381.1.34724 WP_003412381.1.34740 WP_003412381.1.34755 WP_003412381.1.34777 WP_003412381.1.34783 WP_003412381.1.34841 WP_003412381.1.34908 WP_003412381.1.34919 WP_003412381.1.3492 WP_003412381.1.34933 WP_003412381.1.34945 WP_003412381.1.34946 WP_003412381.1.34954 WP_003412381.1.34960 WP_003412381.1.34961 WP_003412381.1.34963 WP_003412381.1.34965 WP_003412381.1.34968 WP_003412381.1.35023 WP_003412381.1.35069 WP_003412381.1.35072 WP_003412381.1.35078 WP_003412381.1.35100 WP_003412381.1.35146 WP_003412381.1.35156 WP_003412381.1.35160 WP_003412381.1.35173 WP_003412381.1.35176 WP_003412381.1.3520 WP_003412381.1.35213 WP_003412381.1.35221 WP_003412381.1.35246 WP_003412381.1.35278 WP_003412381.1.35301 WP_003412381.1.35311 WP_003412381.1.35312 WP_003412381.1.35317 WP_003412381.1.35319 WP_003412381.1.35347 WP_003412381.1.35363 WP_003412381.1.35382 WP_003412381.1.35385 WP_003412381.1.35396 WP_003412381.1.35397 WP_003412381.1.35426 WP_003412381.1.35439 WP_003412381.1.35455 WP_003412381.1.3548 WP_003412381.1.35484 WP_003412381.1.35492 WP_003412381.1.3553 WP_003412381.1.35553 WP_003412381.1.35555 WP_003412381.1.35561 WP_003412381.1.35602 WP_003412381.1.35610 WP_003412381.1.35635 WP_003412381.1.35657 WP_003412381.1.35687 WP_003412381.1.35689 WP_003412381.1.35707 WP_003412381.1.35732 WP_003412381.1.35754 WP_003412381.1.35767 WP_003412381.1.35770 WP_003412381.1.35771 WP_003412381.1.35780 WP_003412381.1.35805 WP_003412381.1.35811 WP_003412381.1.35821 WP_003412381.1.3584 WP_003412381.1.35848 WP_003412381.1.35864 WP_003412381.1.35874 WP_003412381.1.35876 WP_003412381.1.35897 WP_003412381.1.35899 WP_003412381.1.35923 WP_003412381.1.3593 WP_003412381.1.35954 WP_003412381.1.36005 WP_003412381.1.36014 WP_003412381.1.36023 WP_003412381.1.36053 WP_003412381.1.36075 WP_003412381.1.36089 WP_003412381.1.36097 WP_003412381.1.36098 WP_003412381.1.36116 WP_003412381.1.36145 WP_003412381.1.36156 WP_003412381.1.36205 WP_003412381.1.36228 WP_003412381.1.36246 WP_003412381.1.36252 WP_003412381.1.36260 WP_003412381.1.36270 WP_003412381.1.36303 WP_003412381.1.36309 WP_003412381.1.36315 WP_003412381.1.36319 WP_003412381.1.36321 WP_003412381.1.36326 WP_003412381.1.3634 WP_003412381.1.36356 WP_003412381.1.36357 WP_003412381.1.3636 WP_003412381.1.36385 WP_003412381.1.36399 WP_003412381.1.36436 WP_003412381.1.36465 WP_003412381.1.36469 WP_003412381.1.36485 WP_003412381.1.36508 WP_003412381.1.36540 WP_003412381.1.36561 WP_003412381.1.36571 WP_003412381.1.36573 WP_003412381.1.36578 WP_003412381.1.36585 WP_003412381.1.36597 WP_003412381.1.36614 WP_003412381.1.36657 WP_003412381.1.36674 WP_003412381.1.36720 WP_003412381.1.36727 WP_003412381.1.36733 WP_003412381.1.36810 WP_003412381.1.36844 WP_003412381.1.36851 WP_003412381.1.36862 WP_003412381.1.36893 WP_003412381.1.36901 WP_003412381.1.36935 WP_003412381.1.36941 WP_003412381.1.3695 WP_003412381.1.36951 WP_003412381.1.36968 WP_003412381.1.3700 WP_003412381.1.37004 WP_003412381.1.37012 WP_003412381.1.37071 WP_003412381.1.37088 WP_003412381.1.37131 WP_003412381.1.37157 WP_003412381.1.37175 WP_003412381.1.37188 WP_003412381.1.37213 WP_003412381.1.37229 WP_003412381.1.3724 WP_003412381.1.37277 WP_003412381.1.37305 WP_003412381.1.37330 WP_003412381.1.37389 WP_003412381.1.37400 WP_003412381.1.37440 WP_003412381.1.37459 WP_003412381.1.37468 WP_003412381.1.37475 WP_003412381.1.37484 WP_003412381.1.37601 WP_003412381.1.37612 WP_003412381.1.37632 WP_003412381.1.37643 WP_003412381.1.37655 WP_003412381.1.37660 WP_003412381.1.37674 WP_003412381.1.37700 WP_003412381.1.37701 WP_003412381.1.37709 WP_003412381.1.37711 WP_003412381.1.37721 WP_003412381.1.37722 WP_003412381.1.37747 WP_003412381.1.37765 WP_003412381.1.37772 WP_003412381.1.37804 WP_003412381.1.37809 WP_003412381.1.37859 WP_003412381.1.37877 WP_003412381.1.37912 WP_003412381.1.37913 WP_003412381.1.37943 WP_003412381.1.37950 WP_003412381.1.37973 WP_003412381.1.37975 WP_003412381.1.37983 WP_003412381.1.38 WP_003412381.1.38002 WP_003412381.1.3802 WP_003412381.1.38039 WP_003412381.1.38040 WP_003412381.1.38067 WP_003412381.1.38068 WP_003412381.1.38135 WP_003412381.1.38138 WP_003412381.1.38144 WP_003412381.1.38158 WP_003412381.1.38159 WP_003412381.1.38210 WP_003412381.1.38233 WP_003412381.1.38240 WP_003412381.1.38299 WP_003412381.1.38332 WP_003412381.1.38347 WP_003412381.1.38354 WP_003412381.1.38380 WP_003412381.1.38384 WP_003412381.1.38389 WP_003412381.1.38398 WP_003412381.1.38402 WP_003412381.1.38418 WP_003412381.1.38421 WP_003412381.1.38466 WP_003412381.1.38477 WP_003412381.1.38483 WP_003412381.1.3849 WP_003412381.1.385 WP_003412381.1.38530 WP_003412381.1.38535 WP_003412381.1.38539 WP_003412381.1.38594 WP_003412381.1.38601 WP_003412381.1.38611 WP_003412381.1.38638 WP_003412381.1.38639 WP_003412381.1.38646 WP_003412381.1.38648 WP_003412381.1.38654 WP_003412381.1.38659 WP_003412381.1.38660 WP_003412381.1.38666 WP_003412381.1.38671 WP_003412381.1.38672 WP_003412381.1.38677 WP_003412381.1.38750 WP_003412381.1.38772 WP_003412381.1.38812 WP_003412381.1.38821 WP_003412381.1.38844 WP_003412381.1.38863 WP_003412381.1.38865 WP_003412381.1.38873 WP_003412381.1.3889 WP_003412381.1.38894 WP_003412381.1.38909 WP_003412381.1.38939 WP_003412381.1.38974 WP_003412381.1.38975 WP_003412381.1.38991 WP_003412381.1.39025 WP_003412381.1.39070 WP_003412381.1.39072 WP_003412381.1.39095 WP_003412381.1.39165 WP_003412381.1.39174 WP_003412381.1.39176 WP_003412381.1.39178 WP_003412381.1.39190 WP_003412381.1.39201 WP_003412381.1.39207 WP_003412381.1.39211 WP_003412381.1.39236 WP_003412381.1.39239 WP_003412381.1.39252 WP_003412381.1.39288 WP_003412381.1.39295 WP_003412381.1.39306 WP_003412381.1.39359 WP_003412381.1.39364 WP_003412381.1.39400 WP_003412381.1.39447 WP_003412381.1.3945 WP_003412381.1.39450 WP_003412381.1.39455 WP_003412381.1.3949 WP_003412381.1.39521 WP_003412381.1.39560 WP_003412381.1.39592 WP_003412381.1.39593 WP_003412381.1.396 WP_003412381.1.3960 WP_003412381.1.39616 WP_003412381.1.39654 WP_003412381.1.39657 WP_003412381.1.39661 WP_003412381.1.39674 WP_003412381.1.39678 WP_003412381.1.3968 WP_003412381.1.39694 WP_003412381.1.3971 WP_003412381.1.39718 WP_003412381.1.39728 WP_003412381.1.39739 WP_003412381.1.39748 WP_003412381.1.39751 WP_003412381.1.39759 WP_003412381.1.39801 WP_003412381.1.39804 WP_003412381.1.39848 WP_003412381.1.39877 WP_003412381.1.39925 WP_003412381.1.3994 WP_003412381.1.39959 WP_003412381.1.3996 WP_003412381.1.39960 WP_003412381.1.3997 WP_003412381.1.39980 WP_003412381.1.40000 WP_003412381.1.40028 WP_003412381.1.40029 WP_003412381.1.4003 WP_003412381.1.40094 WP_003412381.1.40096 WP_003412381.1.40150 WP_003412381.1.40156 WP_003412381.1.40174 WP_003412381.1.40186 WP_003412381.1.40276 WP_003412381.1.40277 WP_003412381.1.40323 WP_003412381.1.40336 WP_003412381.1.40353 WP_003412381.1.4036 WP_003412381.1.40372 WP_003412381.1.40402 WP_003412381.1.40413 WP_003412381.1.40446 WP_003412381.1.40451 WP_003412381.1.40455 WP_003412381.1.40523 WP_003412381.1.40543 WP_003412381.1.40641 WP_003412381.1.40646 WP_003412381.1.40651 WP_003412381.1.40653 WP_003412381.1.4067 WP_003412381.1.40705 WP_003412381.1.40723 WP_003412381.1.40731 WP_003412381.1.40735 WP_003412381.1.40799 WP_003412381.1.40852 WP_003412381.1.40876 WP_003412381.1.40881 WP_003412381.1.40922 WP_003412381.1.40948 WP_003412381.1.4095 WP_003412381.1.40956 WP_003412381.1.40957 WP_003412381.1.40964 WP_003412381.1.4097 WP_003412381.1.410 WP_003412381.1.41000 WP_003412381.1.41055 WP_003412381.1.41108 WP_003412381.1.41123 WP_003412381.1.41177 WP_003412381.1.41202 WP_003412381.1.41219 WP_003412381.1.41231 WP_003412381.1.41249 WP_003412381.1.4127 WP_003412381.1.41296 WP_003412381.1.41355 WP_003412381.1.41430 WP_003412381.1.41447 WP_003412381.1.41469 WP_003412381.1.41504 WP_003412381.1.41564 WP_003412381.1.41583 WP_003412381.1.41616 WP_003412381.1.41632 WP_003412381.1.41635 WP_003412381.1.41636 WP_003412381.1.41648 WP_003412381.1.41660 WP_003412381.1.41685 WP_003412381.1.41695 WP_003412381.1.41704 WP_003412381.1.4171 WP_003412381.1.41719 WP_003412381.1.41733 WP_003412381.1.41744 WP_003412381.1.41774 WP_003412381.1.41791 WP_003412381.1.41820 WP_003412381.1.41828 WP_003412381.1.41829 WP_003412381.1.41860 WP_003412381.1.41912 WP_003412381.1.41921 WP_003412381.1.41933 WP_003412381.1.41944 WP_003412381.1.42043 WP_003412381.1.42075 WP_003412381.1.42078 WP_003412381.1.42094 WP_003412381.1.42112 WP_003412381.1.4212 WP_003412381.1.42122 WP_003412381.1.42134 WP_003412381.1.42183 WP_003412381.1.42188 WP_003412381.1.42201 WP_003412381.1.42202 WP_003412381.1.42208 WP_003412381.1.42247 WP_003412381.1.42255 WP_003412381.1.42273 WP_003412381.1.42278 WP_003412381.1.42304 WP_003412381.1.42309 WP_003412381.1.42370 WP_003412381.1.42385 WP_003412381.1.42400 WP_003412381.1.42409 WP_003412381.1.42414 WP_003412381.1.42417 WP_003412381.1.42430 WP_003412381.1.42465 WP_003412381.1.42467 WP_003412381.1.42473 WP_003412381.1.42474 WP_003412381.1.42494 WP_003412381.1.42519 WP_003412381.1.42524 WP_003412381.1.42534 WP_003412381.1.42562 WP_003412381.1.42568 WP_003412381.1.42570 WP_003412381.1.42618 WP_003412381.1.42660 WP_003412381.1.42695 WP_003412381.1.42704 WP_003412381.1.42705 WP_003412381.1.42722 WP_003412381.1.42777 WP_003412381.1.42782 WP_003412381.1.42835 WP_003412381.1.42839 WP_003412381.1.42842 WP_003412381.1.42905 WP_003412381.1.42916 WP_003412381.1.42930 WP_003412381.1.42971 WP_003412381.1.43005 WP_003412381.1.43009 WP_003412381.1.43053 WP_003412381.1.43082 WP_003412381.1.43087 WP_003412381.1.43098 WP_003412381.1.43208 WP_003412381.1.43236 WP_003412381.1.43246 WP_003412381.1.43255 WP_003412381.1.43266 WP_003412381.1.43269 WP_003412381.1.43273 WP_003412381.1.43296 WP_003412381.1.43306 WP_003412381.1.4335 WP_003412381.1.43368 WP_003412381.1.43395 WP_003412381.1.43462 WP_003412381.1.43475 WP_003412381.1.43478 WP_003412381.1.43484 WP_003412381.1.43557 WP_003412381.1.43578 WP_003412381.1.43588 WP_003412381.1.43643 WP_003412381.1.43664 WP_003412381.1.43684 WP_003412381.1.43686 WP_003412381.1.43706 WP_003412381.1.43716 WP_003412381.1.4377 WP_003412381.1.43781 WP_003412381.1.43794 WP_003412381.1.43815 WP_003412381.1.43846 WP_003412381.1.43861 WP_003412381.1.43863 WP_003412381.1.43866 WP_003412381.1.43872 WP_003412381.1.43885 WP_003412381.1.43897 WP_003412381.1.4390 WP_003412381.1.43902 WP_003412381.1.43921 WP_003412381.1.43936 WP_003412381.1.43937 WP_003412381.1.43960 WP_003412381.1.43965 WP_003412381.1.4399 WP_003412381.1.43993 WP_003412381.1.43996 WP_003412381.1.44 WP_003412381.1.44001 WP_003412381.1.44008 WP_003412381.1.44016 WP_003412381.1.44033 WP_003412381.1.44037 WP_003412381.1.44041 WP_003412381.1.44070 WP_003412381.1.44071 WP_003412381.1.44076 WP_003412381.1.44104 WP_003412381.1.44111 WP_003412381.1.44124 WP_003412381.1.44169 WP_003412381.1.44219 WP_003412381.1.44237 WP_003412381.1.44277 WP_003412381.1.44279 WP_003412381.1.44336 WP_003412381.1.44355 WP_003412381.1.44358 WP_003412381.1.4438 WP_003412381.1.44392 WP_003412381.1.4441 WP_003412381.1.44415 WP_003412381.1.44464 WP_003412381.1.44466 WP_003412381.1.44489 WP_003412381.1.44492 WP_003412381.1.44494 WP_003412381.1.44500 WP_003412381.1.44519 WP_003412381.1.44526 WP_003412381.1.44532 WP_003412381.1.44534 WP_003412381.1.44562 WP_003412381.1.44589 WP_003412381.1.44597 WP_003412381.1.44600 WP_003412381.1.44602 WP_003412381.1.44615 WP_003412381.1.4464 WP_003412381.1.44651 WP_003412381.1.44659 WP_003412381.1.44665 WP_003412381.1.44694 WP_003412381.1.44700 WP_003412381.1.44713 WP_003412381.1.44735 WP_003412381.1.44740 WP_003412381.1.44757 WP_003412381.1.4476 WP_003412381.1.44761 WP_003412381.1.44767 WP_003412381.1.44776 WP_003412381.1.44779 WP_003412381.1.44786 WP_003412381.1.44808 WP_003412381.1.44864 WP_003412381.1.44901 WP_003412381.1.44908 WP_003412381.1.44913 WP_003412381.1.4492 WP_003412381.1.44939 WP_003412381.1.44979 WP_003412381.1.44981 WP_003412381.1.45002 WP_003412381.1.45011 WP_003412381.1.4504 WP_003412381.1.45062 WP_003412381.1.45066 WP_003412381.1.45081 WP_003412381.1.45113 WP_003412381.1.45129 WP_003412381.1.45135 WP_003412381.1.45147 WP_003412381.1.45168 WP_003412381.1.4517 WP_003412381.1.45181 WP_003412381.1.45185 WP_003412381.1.45192 WP_003412381.1.45200 WP_003412381.1.45205 WP_003412381.1.45211 WP_003412381.1.45249 WP_003412381.1.4526 WP_003412381.1.45286 WP_003412381.1.45326 WP_003412381.1.45347 WP_003412381.1.45374 WP_003412381.1.45390 WP_003412381.1.454 WP_003412381.1.45407 WP_003412381.1.45451 WP_003412381.1.45453 WP_003412381.1.45460 WP_003412381.1.45463 WP_003412381.1.45470 WP_003412381.1.45474 WP_003412381.1.45491 WP_003412381.1.45510 WP_003412381.1.45563 WP_003412381.1.45584 WP_003412381.1.45590 WP_003412381.1.45619 WP_003412381.1.45626 WP_003412381.1.45631 WP_003412381.1.45666 WP_003412381.1.45697 WP_003412381.1.4571 WP_003412381.1.45731 WP_003412381.1.45743 WP_003412381.1.45765 WP_003412381.1.45776 WP_003412381.1.45783 WP_003412381.1.45805 WP_003412381.1.45815 WP_003412381.1.45849 WP_003412381.1.45884 WP_003412381.1.4590 WP_003412381.1.45923 WP_003412381.1.45926 WP_003412381.1.45963 WP_003412381.1.45989 WP_003412381.1.45992 WP_003412381.1.46025 WP_003412381.1.46083 WP_003412381.1.46090 WP_003412381.1.46092 WP_003412381.1.46100 WP_003412381.1.46101 WP_003412381.1.46103 WP_003412381.1.46107 WP_003412381.1.46127 WP_003412381.1.46128 WP_003412381.1.46129 WP_003412381.1.46141 WP_003412381.1.46150 WP_003412381.1.46201 WP_003412381.1.46226 WP_003412381.1.4624 WP_003412381.1.46253 WP_003412381.1.46268 WP_003412381.1.46285 WP_003412381.1.46300 WP_003412381.1.46313 WP_003412381.1.46336 WP_003412381.1.46365 WP_003412381.1.46370 WP_003412381.1.46381 WP_003412381.1.46402 WP_003412381.1.46411 WP_003412381.1.4644 WP_003412381.1.46442 WP_003412381.1.46453 WP_003412381.1.46463 WP_003412381.1.46478 WP_003412381.1.46492 WP_003412381.1.46521 WP_003412381.1.4653 WP_003412381.1.46532 WP_003412381.1.46539 WP_003412381.1.46568 WP_003412381.1.46585 WP_003412381.1.46609 WP_003412381.1.46613 WP_003412381.1.46625 WP_003412381.1.46642 WP_003412381.1.46647 WP_003412381.1.46674 WP_003412381.1.46724 WP_003412381.1.46773 WP_003412381.1.46777 WP_003412381.1.46786 WP_003412381.1.46792 WP_003412381.1.46847 WP_003412381.1.46851 WP_003412381.1.4687 WP_003412381.1.46897 WP_003412381.1.46936 WP_003412381.1.46980 WP_003412381.1.47011 WP_003412381.1.47012 WP_003412381.1.47066 WP_003412381.1.47077 WP_003412381.1.47083 WP_003412381.1.47106 WP_003412381.1.47142 WP_003412381.1.47147 WP_003412381.1.47166 WP_003412381.1.47178 WP_003412381.1.47179 WP_003412381.1.47194 WP_003412381.1.47207 WP_003412381.1.47210 WP_003412381.1.47261 WP_003412381.1.47262 WP_003412381.1.47402 WP_003412381.1.47423 WP_003412381.1.47467 WP_003412381.1.47502 WP_003412381.1.4751 WP_003412381.1.47511 WP_003412381.1.47537 WP_003412381.1.47540 WP_003412381.1.47568 WP_003412381.1.47572 WP_003412381.1.47636 WP_003412381.1.4764 WP_003412381.1.47679 WP_003412381.1.47681 WP_003412381.1.47690 WP_003412381.1.4771 WP_003412381.1.47717 WP_003412381.1.47743 WP_003412381.1.47754 WP_003412381.1.47773 WP_003412381.1.47776 WP_003412381.1.47780 WP_003412381.1.47805 WP_003412381.1.47832 WP_003412381.1.47847 WP_003412381.1.47858 WP_003412381.1.47868 WP_003412381.1.47893 WP_003412381.1.47899 WP_003412381.1.479 WP_003412381.1.47912 WP_003412381.1.47913 WP_003412381.1.47926 WP_003412381.1.4794 WP_003412381.1.47943 WP_003412381.1.47944 WP_003412381.1.47959 WP_003412381.1.47974 WP_003412381.1.47993 WP_003412381.1.48004 WP_003412381.1.48039 WP_003412381.1.48050 WP_003412381.1.48097 WP_003412381.1.48101 WP_003412381.1.48109 WP_003412381.1.4813 WP_003412381.1.48130 WP_003412381.1.48135 WP_003412381.1.48143 WP_003412381.1.48152 WP_003412381.1.48155 WP_003412381.1.48170 WP_003412381.1.48173 WP_003412381.1.48177 WP_003412381.1.48185 WP_003412381.1.48204 WP_003412381.1.48219 WP_003412381.1.4823 WP_003412381.1.48240 WP_003412381.1.48256 WP_003412381.1.48264 WP_003412381.1.48287 WP_003412381.1.48330 WP_003412381.1.48333 WP_003412381.1.48348 WP_003412381.1.48354 WP_003412381.1.48372 WP_003412381.1.48383 WP_003412381.1.48388 WP_003412381.1.48419 WP_003412381.1.48423 WP_003412381.1.48443 WP_003412381.1.48450 WP_003412381.1.48462 WP_003412381.1.48543 WP_003412381.1.48550 WP_003412381.1.48605 WP_003412381.1.4863 WP_003412381.1.48648 WP_003412381.1.48658 WP_003412381.1.48666 WP_003412381.1.48687 WP_003412381.1.48779 WP_003412381.1.4878 WP_003412381.1.48798 WP_003412381.1.48802 WP_003412381.1.48826 WP_003412381.1.48831 WP_003412381.1.48843 WP_003412381.1.48857 WP_003412381.1.4890 WP_003412381.1.48946 WP_003412381.1.48979 WP_003412381.1.49017 WP_003412381.1.49048 WP_003412381.1.49059 WP_003412381.1.4906 WP_003412381.1.4907 WP_003412381.1.49103 WP_003412381.1.49110 WP_003412381.1.49111 WP_003412381.1.49112 WP_003412381.1.4919 WP_003412381.1.49251 WP_003412381.1.49254 WP_003412381.1.49263 WP_003412381.1.49291 WP_003412381.1.49296 WP_003412381.1.49335 WP_003412381.1.49337 WP_003412381.1.49419 WP_003412381.1.49426 WP_003412381.1.49437 WP_003412381.1.49439 WP_003412381.1.49474 WP_003412381.1.49506 WP_003412381.1.49516 WP_003412381.1.49523 WP_003412381.1.49526 WP_003412381.1.49532 WP_003412381.1.49588 WP_003412381.1.4959 WP_003412381.1.49678 WP_003412381.1.49687 WP_003412381.1.49699 WP_003412381.1.49709 WP_003412381.1.4971 WP_003412381.1.4972 WP_003412381.1.49736 WP_003412381.1.49746 WP_003412381.1.49764 WP_003412381.1.49773 WP_003412381.1.49796 WP_003412381.1.49814 WP_003412381.1.49815 WP_003412381.1.49816 WP_003412381.1.49839 WP_003412381.1.49857 WP_003412381.1.49878 WP_003412381.1.49880 WP_003412381.1.49944 WP_003412381.1.4999 WP_003412381.1.49990 WP_003412381.1.50068 WP_003412381.1.5008 WP_003412381.1.50081 WP_003412381.1.50122 WP_003412381.1.50126 WP_003412381.1.50149 WP_003412381.1.50162 WP_003412381.1.5018 WP_003412381.1.50194 WP_003412381.1.50218 WP_003412381.1.50235 WP_003412381.1.50249 WP_003412381.1.50265 WP_003412381.1.50271 WP_003412381.1.50324 WP_003412381.1.50347 WP_003412381.1.50372 WP_003412381.1.50398 WP_003412381.1.50407 WP_003412381.1.50444 WP_003412381.1.50466 WP_003412381.1.50472 WP_003412381.1.5048 WP_003412381.1.50498 WP_003412381.1.5050 WP_003412381.1.50540 WP_003412381.1.50554 WP_003412381.1.50557 WP_003412381.1.50610 WP_003412381.1.50632 WP_003412381.1.50633 WP_003412381.1.50642 WP_003412381.1.50655 WP_003412381.1.50659 WP_003412381.1.50683 WP_003412381.1.50692 WP_003412381.1.50714 WP_003412381.1.50729 WP_003412381.1.50756 WP_003412381.1.50784 WP_003412381.1.50794 WP_003412381.1.50841 WP_003412381.1.50860 WP_003412381.1.50868 WP_003412381.1.50877 WP_003412381.1.5096 WP_003412381.1.50981 WP_003412381.1.50987 WP_003412381.1.51009 WP_003412381.1.51037 WP_003412381.1.51074 WP_003412381.1.51082 WP_003412381.1.51101 WP_003412381.1.51116 WP_003412381.1.51149 WP_003412381.1.51156 WP_003412381.1.51157 WP_003412381.1.51213 WP_003412381.1.51232 WP_003412381.1.51239 WP_003412381.1.51247 WP_003412381.1.51266 WP_003412381.1.51279 WP_003412381.1.51291 WP_003412381.1.51294 WP_003412381.1.51301 WP_003412381.1.51329 WP_003412381.1.51391 WP_003412381.1.51422 WP_003412381.1.51445 WP_003412381.1.51455 WP_003412381.1.51466 WP_003412381.1.51468 WP_003412381.1.51478 WP_003412381.1.51497 WP_003412381.1.51520 WP_003412381.1.51593 WP_003412381.1.51628 WP_003412381.1.5164 WP_003412381.1.51647 WP_003412381.1.51660 WP_003412381.1.51696 WP_003412381.1.51721 WP_003412381.1.51788 WP_003412381.1.51795 WP_003412381.1.51801 WP_003412381.1.51817 WP_003412381.1.51819 WP_003412381.1.51854 WP_003412381.1.51923 WP_003412381.1.51942 WP_003412381.1.51948 WP_003412381.1.51963 WP_003412381.1.51969 WP_003412381.1.52000 WP_003412381.1.52001 WP_003412381.1.52003 WP_003412381.1.52006 WP_003412381.1.52036 WP_003412381.1.52038 WP_003412381.1.52046 WP_003412381.1.52059 WP_003412381.1.52069 WP_003412381.1.52082 WP_003412381.1.52102 WP_003412381.1.52106 WP_003412381.1.52166 WP_003412381.1.52168 WP_003412381.1.52173 WP_003412381.1.52178 WP_003412381.1.52206 WP_003412381.1.52216 WP_003412381.1.52238 WP_003412381.1.52241 WP_003412381.1.52280 WP_003412381.1.52314 WP_003412381.1.52385 WP_003412381.1.52390 WP_003412381.1.524 WP_003412381.1.52460 WP_003412381.1.52485 WP_003412381.1.52486 WP_003412381.1.52495 WP_003412381.1.52504 WP_003412381.1.52522 WP_003412381.1.52531 WP_003412381.1.52533 WP_003412381.1.52545 WP_003412381.1.52553 WP_003412381.1.52563 WP_003412381.1.52564 WP_003412381.1.52574 WP_003412381.1.52641 WP_003412381.1.52673 WP_003412381.1.52674 WP_003412381.1.52708 WP_003412381.1.52713 WP_003412381.1.52761 WP_003412381.1.52778 WP_003412381.1.52791 WP_003412381.1.52797 WP_003412381.1.52818 WP_003412381.1.52872 WP_003412381.1.52873 WP_003412381.1.52891 WP_003412381.1.52892 WP_003412381.1.52909 WP_003412381.1.52970 WP_003412381.1.52998 WP_003412381.1.53053 WP_003412381.1.53056 WP_003412381.1.5306 WP_003412381.1.53088 WP_003412381.1.5309 WP_003412381.1.531 WP_003412381.1.53117 WP_003412381.1.53118 WP_003412381.1.53142 WP_003412381.1.53143 WP_003412381.1.53157 WP_003412381.1.53167 WP_003412381.1.53200 WP_003412381.1.53204 WP_003412381.1.53213 WP_003412381.1.53217 WP_003412381.1.53226 WP_003412381.1.53229 WP_003412381.1.53230 WP_003412381.1.53237 WP_003412381.1.53254 WP_003412381.1.53257 WP_003412381.1.5327 WP_003412381.1.53276 WP_003412381.1.53278 WP_003412381.1.53302 WP_003412381.1.53306 WP_003412381.1.5334 WP_003412381.1.5335 WP_003412381.1.53353 WP_003412381.1.53381 WP_003412381.1.53413 WP_003412381.1.53458 WP_003412381.1.53460 WP_003412381.1.53480 WP_003412381.1.53517 WP_003412381.1.53522 WP_003412381.1.53525 WP_003412381.1.53526 WP_003412381.1.53553 WP_003412381.1.53606 WP_003412381.1.53609 WP_003412381.1.53628 WP_003412381.1.53643 WP_003412381.1.53667 WP_003412381.1.53679 WP_003412381.1.53715 WP_003412381.1.53730 WP_003412381.1.53742 WP_003412381.1.53743 WP_003412381.1.53754 WP_003412381.1.53775 WP_003412381.1.53787 WP_003412381.1.53803 WP_003412381.1.53818 WP_003412381.1.53822 WP_003412381.1.53853 WP_003412381.1.53865 WP_003412381.1.53888 WP_003412381.1.53900 WP_003412381.1.53912 WP_003412381.1.53914 WP_003412381.1.53952 WP_003412381.1.53973 WP_003412381.1.5398 WP_003412381.1.5408 WP_003412381.1.54089 WP_003412381.1.54093 WP_003412381.1.54099 WP_003412381.1.54112 WP_003412381.1.54125 WP_003412381.1.54141 WP_003412381.1.54162 WP_003412381.1.54179 WP_003412381.1.54206 WP_003412381.1.54218 WP_003412381.1.54225 WP_003412381.1.54227 WP_003412381.1.54232 WP_003412381.1.54241 WP_003412381.1.54245 WP_003412381.1.54247 WP_003412381.1.54260 WP_003412381.1.54275 WP_003412381.1.54280 WP_003412381.1.5429 WP_003412381.1.54294 WP_003412381.1.54314 WP_003412381.1.54347 WP_003412381.1.54351 WP_003412381.1.54370 WP_003412381.1.54428 WP_003412381.1.54449 WP_003412381.1.54494 WP_003412381.1.54502 WP_003412381.1.54514 WP_003412381.1.54519 WP_003412381.1.5452 WP_003412381.1.54531 WP_003412381.1.54537 WP_003412381.1.54553 WP_003412381.1.54555 WP_003412381.1.54575 WP_003412381.1.54633 WP_003412381.1.54686 WP_003412381.1.54687 WP_003412381.1.54705 WP_003412381.1.54730 WP_003412381.1.54732 WP_003412381.1.5475 WP_003412381.1.54797 WP_003412381.1.54807 WP_003412381.1.54836 WP_003412381.1.54838 WP_003412381.1.54860 WP_003412381.1.54888 WP_003412381.1.54905 WP_003412381.1.54909 WP_003412381.1.54937 WP_003412381.1.54939 WP_003412381.1.54944 WP_003412381.1.54945 WP_003412381.1.54953 WP_003412381.1.54964 WP_003412381.1.55015 WP_003412381.1.55023 WP_003412381.1.55051 WP_003412381.1.55072 WP_003412381.1.55106 WP_003412381.1.55126 WP_003412381.1.55128 WP_003412381.1.55140 WP_003412381.1.55210 WP_003412381.1.55227 WP_003412381.1.55248 WP_003412381.1.55257 WP_003412381.1.55258 WP_003412381.1.55267 WP_003412381.1.55279 WP_003412381.1.55307 WP_003412381.1.55326 WP_003412381.1.55328 WP_003412381.1.5533 WP_003412381.1.55396 WP_003412381.1.55398 WP_003412381.1.55441 WP_003412381.1.55459 WP_003412381.1.55501 WP_003412381.1.55504 WP_003412381.1.55578 WP_003412381.1.55626 WP_003412381.1.55641 WP_003412381.1.5569 WP_003412381.1.55723 WP_003412381.1.55735 WP_003412381.1.5574 WP_003412381.1.55772 WP_003412381.1.55802 WP_003412381.1.55807 WP_003412381.1.55819 WP_003412381.1.55821 WP_003412381.1.5583 WP_003412381.1.55849 WP_003412381.1.55856 WP_003412381.1.55860 WP_003412381.1.55882 WP_003412381.1.55883 WP_003412381.1.55894 WP_003412381.1.55902 WP_003412381.1.55908 WP_003412381.1.55909 WP_003412381.1.5591 WP_003412381.1.55961 WP_003412381.1.55977 WP_003412381.1.55983 WP_003412381.1.56028 WP_003412381.1.56060 WP_003412381.1.56132 WP_003412381.1.56163 WP_003412381.1.56167 WP_003412381.1.56178 WP_003412381.1.56287 WP_003412381.1.56292 WP_003412381.1.56327 WP_003412381.1.56341 WP_003412381.1.56359 WP_003412381.1.56365 WP_003412381.1.56394 WP_003412381.1.56443 WP_003412381.1.56473 WP_003412381.1.56478 WP_003412381.1.56500 WP_003412381.1.56517 WP_003412381.1.56534 WP_003412381.1.5656 WP_003412381.1.56577 WP_003412381.1.56593 WP_003412381.1.56625 WP_003412381.1.56637 WP_003412381.1.56670 WP_003412381.1.56697 WP_003412381.1.567 WP_003412381.1.56701 WP_003412381.1.56709 WP_003412381.1.56729 WP_003412381.1.56743 WP_003412381.1.56755 WP_003412381.1.56764 WP_003412381.1.56769 WP_003412381.1.56795 WP_003412381.1.5681 WP_003412381.1.56827 WP_003412381.1.56839 WP_003412381.1.56863 WP_003412381.1.56868 WP_003412381.1.56869 WP_003412381.1.56915 WP_003412381.1.56926 WP_003412381.1.56961 WP_003412381.1.56971 WP_003412381.1.56972 WP_003412381.1.57023 WP_003412381.1.57035 WP_003412381.1.57077 WP_003412381.1.57087 WP_003412381.1.57134 WP_003412381.1.57151 WP_003412381.1.57169 WP_003412381.1.57208 WP_003412381.1.57212 WP_003412381.1.57230 WP_003412381.1.5724 WP_003412381.1.5725 WP_003412381.1.5727 WP_003412381.1.57273 WP_003412381.1.573 WP_003412381.1.57314 WP_003412381.1.57326 WP_003412381.1.57328 WP_003412381.1.57331 WP_003412381.1.57340 WP_003412381.1.57351 WP_003412381.1.57352 WP_003412381.1.57380 WP_003412381.1.57430 WP_003412381.1.5744 WP_003412381.1.57440 WP_003412381.1.5745 WP_003412381.1.57461 WP_003412381.1.57469 WP_003412381.1.57489 WP_003412381.1.575 WP_003412381.1.57509 WP_003412381.1.57519 WP_003412381.1.57525 WP_003412381.1.57551 WP_003412381.1.5758 WP_003412381.1.57596 WP_003412381.1.57604 WP_003412381.1.57616 WP_003412381.1.57617 WP_003412381.1.57619 WP_003412381.1.57627 WP_003412381.1.57642 WP_003412381.1.57658 WP_003412381.1.57667 WP_003412381.1.57675 WP_003412381.1.57708 WP_003412381.1.57821 WP_003412381.1.57825 WP_003412381.1.57843 WP_003412381.1.57906 WP_003412381.1.57924 WP_003412381.1.57926 WP_003412381.1.57930 WP_003412381.1.57957 WP_003412381.1.57960 WP_003412381.1.57964 WP_003412381.1.57991 WP_003412381.1.58086 WP_003412381.1.58101 WP_003412381.1.58103 WP_003412381.1.58108 WP_003412381.1.5811 WP_003412381.1.58121 WP_003412381.1.58145 WP_003412381.1.58164 WP_003412381.1.58174 WP_003412381.1.582 WP_003412381.1.58202 WP_003412381.1.58209 WP_003412381.1.5824 WP_003412381.1.58250 WP_003412381.1.58259 WP_003412381.1.58283 WP_003412381.1.58288 WP_003412381.1.5830 WP_003412381.1.58303 WP_003412381.1.58311 WP_003412381.1.58330 WP_003412381.1.58359 WP_003412381.1.58386 WP_003412381.1.58393 WP_003412381.1.58431 WP_003412381.1.5844 WP_003412381.1.58457 WP_003412381.1.58488 WP_003412381.1.58518 WP_003412381.1.58534 WP_003412381.1.58559 WP_003412381.1.58567 WP_003412381.1.58573 WP_003412381.1.58602 WP_003412381.1.58612 WP_003412381.1.58619 WP_003412381.1.58630 WP_003412381.1.5865 WP_003412381.1.58671 WP_003412381.1.58690 WP_003412381.1.58702 WP_003412381.1.58743 WP_003412381.1.58754 WP_003412381.1.5879 WP_003412381.1.5881 WP_003412381.1.58848 WP_003412381.1.58857 WP_003412381.1.58891 WP_003412381.1.58892 WP_003412381.1.5890 WP_003412381.1.58904 WP_003412381.1.58921 WP_003412381.1.58930 WP_003412381.1.58939 WP_003412381.1.58941 WP_003412381.1.58953 WP_003412381.1.58961 WP_003412381.1.5898 WP_003412381.1.59029 WP_003412381.1.59037 WP_003412381.1.59044 WP_003412381.1.59085 WP_003412381.1.59088 WP_003412381.1.5914 WP_003412381.1.59147 WP_003412381.1.59166 WP_003412381.1.59205 WP_003412381.1.59209 WP_003412381.1.59237 WP_003412381.1.59240 WP_003412381.1.59253 WP_003412381.1.59254 WP_003412381.1.59262 WP_003412381.1.59270 WP_003412381.1.5928 WP_003412381.1.59304 WP_003412381.1.59305 WP_003412381.1.59309 WP_003412381.1.59316 WP_003412381.1.59326 WP_003412381.1.59328 WP_003412381.1.59333 WP_003412381.1.59388 WP_003412381.1.59428 WP_003412381.1.59487 WP_003412381.1.59537 WP_003412381.1.59561 WP_003412381.1.59677 WP_003412381.1.59722 WP_003412381.1.59732 WP_003412381.1.59738 WP_003412381.1.59757 WP_003412381.1.59761 WP_003412381.1.59808 WP_003412381.1.59850 WP_003412381.1.59856 WP_003412381.1.59860 WP_003412381.1.59861 WP_003412381.1.5987 WP_003412381.1.59878 WP_003412381.1.59888 WP_003412381.1.59952 WP_003412381.1.5996 WP_003412381.1.59961 WP_003412381.1.59974 WP_003412381.1.6000 WP_003412381.1.60007 WP_003412381.1.60016 WP_003412381.1.6003 WP_003412381.1.60047 WP_003412381.1.6007 WP_003412381.1.60121 WP_003412381.1.60135 WP_003412381.1.60139 WP_003412381.1.60152 WP_003412381.1.60171 WP_003412381.1.60197 WP_003412381.1.6020 WP_003412381.1.60205 WP_003412381.1.60207 WP_003412381.1.60215 WP_003412381.1.60217 WP_003412381.1.60267 WP_003412381.1.60288 WP_003412381.1.60301 WP_003412381.1.60305 WP_003412381.1.60312 WP_003412381.1.60313 WP_003412381.1.60314 WP_003412381.1.60367 WP_003412381.1.60376 WP_003412381.1.60403 WP_003412381.1.60413 WP_003412381.1.60421 WP_003412381.1.60451 WP_003412381.1.60460 WP_003412381.1.60479 WP_003412381.1.60512 WP_003412381.1.60573 WP_003412381.1.60583 WP_003412381.1.60632 WP_003412381.1.60657 WP_003412381.1.60687 WP_003412381.1.60689 WP_003412381.1.60727 WP_003412381.1.60738 WP_003412381.1.60763 WP_003412381.1.6077 WP_003412381.1.60791 WP_003412381.1.60834 WP_003412381.1.60870 WP_003412381.1.60878 WP_003412381.1.60879 WP_003412381.1.60913 WP_003412381.1.60978 WP_003412381.1.61000 WP_003412381.1.61001 WP_003412381.1.61012 WP_003412381.1.61014 WP_003412381.1.61015 WP_003412381.1.61037 WP_003412381.1.61052 WP_003412381.1.61065 WP_003412381.1.61100 WP_003412381.1.61101 WP_003412381.1.61138 WP_003412381.1.61142 WP_003412381.1.61198 WP_003412381.1.61234 WP_003412381.1.61256 WP_003412381.1.61281 WP_003412381.1.61314 WP_003412381.1.61321 WP_003412381.1.61326 WP_003412381.1.61328 WP_003412381.1.61368 WP_003412381.1.61391 WP_003412381.1.61406 WP_003412381.1.61409 WP_003412381.1.61420 WP_003412381.1.61422 WP_003412381.1.61425 WP_003412381.1.61428 WP_003412381.1.61469 WP_003412381.1.61494 WP_003412381.1.61522 WP_003412381.1.61552 WP_003412381.1.61557 WP_003412381.1.61567 WP_003412381.1.61571 WP_003412381.1.61573 WP_003412381.1.61584 WP_003412381.1.61586 WP_003412381.1.6159 WP_003412381.1.61592 WP_003412381.1.6160 WP_003412381.1.61614 WP_003412381.1.6163 WP_003412381.1.61655 WP_003412381.1.61665 WP_003412381.1.61669 WP_003412381.1.61682 WP_003412381.1.61692 WP_003412381.1.61719 WP_003412381.1.61728 WP_003412381.1.61750 WP_003412381.1.61754 WP_003412381.1.61755 WP_003412381.1.61757 WP_003412381.1.61778 WP_003412381.1.6179 WP_003412381.1.61793 WP_003412381.1.61816 WP_003412381.1.61842 WP_003412381.1.61850 WP_003412381.1.61862 WP_003412381.1.61865 WP_003412381.1.61868 WP_003412381.1.61911 WP_003412381.1.61925 WP_003412381.1.61941 WP_003412381.1.61953 WP_003412381.1.61979 WP_003412381.1.61986 WP_003412381.1.61987 WP_003412381.1.62021 WP_003412381.1.62087 WP_003412381.1.62101 WP_003412381.1.62104 WP_003412381.1.6211 WP_003412381.1.62132 WP_003412381.1.62162 WP_003412381.1.62225 WP_003412381.1.62230 WP_003412381.1.62238 WP_003412381.1.62249 WP_003412381.1.62270 WP_003412381.1.62281 WP_003412381.1.62307 WP_003412381.1.6231 WP_003412381.1.62359 WP_003412381.1.62360 WP_003412381.1.62371 WP_003412381.1.62379 WP_003412381.1.62395 WP_003412381.1.62408 WP_003412381.1.62449 WP_003412381.1.62468 WP_003412381.1.6248 WP_003412381.1.62508 WP_003412381.1.62565 WP_003412381.1.62594 WP_003412381.1.62606 WP_003412381.1.62616 WP_003412381.1.62666 WP_003412381.1.62687 WP_003412381.1.62715 WP_003412381.1.62730 WP_003412381.1.62738 WP_003412381.1.62761 WP_003412381.1.62766 WP_003412381.1.62786 WP_003412381.1.62813 WP_003412381.1.62839 WP_003412381.1.62841 WP_003412381.1.62909 WP_003412381.1.62936 WP_003412381.1.6294 WP_003412381.1.6295 WP_003412381.1.62962 WP_003412381.1.63007 WP_003412381.1.63019 WP_003412381.1.63032 WP_003412381.1.63037 WP_003412381.1.63064 WP_003412381.1.63066 WP_003412381.1.63072 WP_003412381.1.6308 WP_003412381.1.63081 WP_003412381.1.63096 WP_003412381.1.63106 WP_003412381.1.6314 WP_003412381.1.63144 WP_003412381.1.63154 WP_003412381.1.63160 WP_003412381.1.63161 WP_003412381.1.63166 WP_003412381.1.63175 WP_003412381.1.63194 WP_003412381.1.6322 WP_003412381.1.63222 WP_003412381.1.63247 WP_003412381.1.63291 WP_003412381.1.63312 WP_003412381.1.63317 WP_003412381.1.63331 WP_003412381.1.63373 WP_003412381.1.63384 WP_003412381.1.63403 WP_003412381.1.63424 WP_003412381.1.63428 WP_003412381.1.6345 WP_003412381.1.63464 WP_003412381.1.63483 WP_003412381.1.63502 WP_003412381.1.63504 WP_003412381.1.63522 WP_003412381.1.63530 WP_003412381.1.63538 WP_003412381.1.63564 WP_003412381.1.63567 WP_003412381.1.63596 WP_003412381.1.63600 WP_003412381.1.63623 WP_003412381.1.63624 WP_003412381.1.63625 WP_003412381.1.63627 WP_003412381.1.63654 WP_003412381.1.63662 WP_003412381.1.63711 WP_003412381.1.63734 WP_003412381.1.63807 WP_003412381.1.63819 WP_003412381.1.63844 WP_003412381.1.63888 WP_003412381.1.63913 WP_003412381.1.63915 WP_003412381.1.63918 WP_003412381.1.63961 WP_003412381.1.64000 WP_003412381.1.64027 WP_003412381.1.64058 WP_003412381.1.64065 WP_003412381.1.6407 WP_003412381.1.64082 WP_003412381.1.64091 WP_003412381.1.64102 WP_003412381.1.64104 WP_003412381.1.64119 WP_003412381.1.64169 WP_003412381.1.64219 WP_003412381.1.6422 WP_003412381.1.64222 WP_003412381.1.64223 WP_003412381.1.64235 WP_003412381.1.64249 WP_003412381.1.6427 WP_003412381.1.64278 WP_003412381.1.64287 WP_003412381.1.64414 WP_003412381.1.64419 WP_003412381.1.6443 WP_003412381.1.64463 WP_003412381.1.64480 WP_003412381.1.64497 WP_003412381.1.64506 WP_003412381.1.64511 WP_003412381.1.64513 WP_003412381.1.64514 WP_003412381.1.64515 WP_003412381.1.64522 WP_003412381.1.64543 WP_003412381.1.6456 WP_003412381.1.64588 WP_003412381.1.64589 WP_003412381.1.64594 WP_003412381.1.64595 WP_003412381.1.64608 WP_003412381.1.64619 WP_003412381.1.64629 WP_003412381.1.6464 WP_003412381.1.64664 WP_003412381.1.64669 WP_003412381.1.64680 WP_003412381.1.64682 WP_003412381.1.64727 WP_003412381.1.64729 WP_003412381.1.64774 WP_003412381.1.64776 WP_003412381.1.64802 WP_003412381.1.64832 WP_003412381.1.6486 WP_003412381.1.64870 WP_003412381.1.64898 WP_003412381.1.64922 WP_003412381.1.64924 WP_003412381.1.6493 WP_003412381.1.64937 WP_003412381.1.64941 WP_003412381.1.64966 WP_003412381.1.64973 WP_003412381.1.65001 WP_003412381.1.65026 WP_003412381.1.65053 WP_003412381.1.65070 WP_003412381.1.65079 WP_003412381.1.65102 WP_003412381.1.65157 WP_003412381.1.65181 WP_003412381.1.65212 WP_003412381.1.65229 WP_003412381.1.6523 WP_003412381.1.65253 WP_003412381.1.65289 WP_003412381.1.65291 WP_003412381.1.65315 WP_003412381.1.65359 WP_003412381.1.6536 WP_003412381.1.65374 WP_003412381.1.65414 WP_003412381.1.65416 WP_003412381.1.65455 WP_003412381.1.65467 WP_003412381.1.65488 WP_003412381.1.65529 WP_003412381.1.65539 WP_003412381.1.65583 WP_003412381.1.65612 WP_003412381.1.65623 WP_003412381.1.65635 WP_003412381.1.65637 WP_003412381.1.65648 WP_003412381.1.65683 WP_003412381.1.65686 WP_003412381.1.65688 WP_003412381.1.65707 WP_003412381.1.65733 WP_003412381.1.65746 WP_003412381.1.65747 WP_003412381.1.65759 WP_003412381.1.65816 WP_003412381.1.65830 WP_003412381.1.65858 WP_003412381.1.65862 WP_003412381.1.65869 WP_003412381.1.65893 WP_003412381.1.65929 WP_003412381.1.65932 WP_003412381.1.65958 WP_003412381.1.65974 WP_003412381.1.66004 WP_003412381.1.66013 WP_003412381.1.6606 WP_003412381.1.66089 WP_003412381.1.66149 WP_003412381.1.66151 WP_003412381.1.66229 WP_003412381.1.66276 WP_003412381.1.66293 WP_003412381.1.66297 WP_003412381.1.66323 WP_003412381.1.66325 WP_003412381.1.6633 WP_003412381.1.66334 WP_003412381.1.66355 WP_003412381.1.66367 WP_003412381.1.66394 WP_003412381.1.66396 WP_003412381.1.66451 WP_003412381.1.66455 WP_003412381.1.66457 WP_003412381.1.66460 WP_003412381.1.66464 WP_003412381.1.66466 WP_003412381.1.66487 WP_003412381.1.66504 WP_003412381.1.66544 WP_003412381.1.66558 WP_003412381.1.66580 WP_003412381.1.66582 WP_003412381.1.66612 WP_003412381.1.66615 WP_003412381.1.66617 WP_003412381.1.66635 WP_003412381.1.66656 WP_003412381.1.66663 WP_003412381.1.66675 WP_003412381.1.66715 WP_003412381.1.66718 WP_003412381.1.66762 WP_003412381.1.66776 WP_003412381.1.66808 WP_003412381.1.66817 WP_003412381.1.66819 WP_003412381.1.66826 WP_003412381.1.66830 WP_003412381.1.66842 WP_003412381.1.66878 WP_003412381.1.66880 WP_003412381.1.66893 WP_003412381.1.66961 WP_003412381.1.67005 WP_003412381.1.6704 WP_003412381.1.67044 WP_003412381.1.67061 WP_003412381.1.67098 WP_003412381.1.67146 WP_003412381.1.67170 WP_003412381.1.67197 WP_003412381.1.67198 WP_003412381.1.6720 WP_003412381.1.67207 WP_003412381.1.67218 WP_003412381.1.67220 WP_003412381.1.67225 WP_003412381.1.67231 WP_003412381.1.6724 WP_003412381.1.67257 WP_003412381.1.67298 WP_003412381.1.67307 WP_003412381.1.67324 WP_003412381.1.67332 WP_003412381.1.67346 WP_003412381.1.67354 WP_003412381.1.67360 WP_003412381.1.67396 WP_003412381.1.67417 WP_003412381.1.67422 WP_003412381.1.67453 WP_003412381.1.67459 WP_003412381.1.6746 WP_003412381.1.67473 WP_003412381.1.67481 WP_003412381.1.67482 WP_003412381.1.67496 WP_003412381.1.67499 WP_003412381.1.67516 WP_003412381.1.67523 WP_003412381.1.67536 WP_003412381.1.67575 WP_003412381.1.67587 WP_003412381.1.67598 WP_003412381.1.67602 WP_003412381.1.67630 WP_003412381.1.67679 WP_003412381.1.67692 WP_003412381.1.67744 WP_003412381.1.6775 WP_003412381.1.67750 WP_003412381.1.6777 WP_003412381.1.67809 WP_003412381.1.67816 WP_003412381.1.67844 WP_003412381.1.67848 WP_003412381.1.67870 WP_003412381.1.67888 WP_003412381.1.67915 WP_003412381.1.67945 WP_003412381.1.67949 WP_003412381.1.67980 WP_003412381.1.67982 WP_003412381.1.68022 WP_003412381.1.68029 WP_003412381.1.68037 WP_003412381.1.68038 WP_003412381.1.68045 WP_003412381.1.68057 WP_003412381.1.68083 WP_003412381.1.68088 WP_003412381.1.68106 WP_003412381.1.68110 WP_003412381.1.68153 WP_003412381.1.68164 WP_003412381.1.68169 WP_003412381.1.68193 WP_003412381.1.68212 WP_003412381.1.68227 WP_003412381.1.68243 WP_003412381.1.6825 WP_003412381.1.68297 WP_003412381.1.68309 WP_003412381.1.68325 WP_003412381.1.68329 WP_003412381.1.68340 WP_003412381.1.68384 WP_003412381.1.68388 WP_003412381.1.68429 WP_003412381.1.6843 WP_003412381.1.68433 WP_003412381.1.68444 WP_003412381.1.68465 WP_003412381.1.68518 WP_003412381.1.68569 WP_003412381.1.68576 WP_003412381.1.68580 WP_003412381.1.68586 WP_003412381.1.68623 WP_003412381.1.68624 WP_003412381.1.68637 WP_003412381.1.68646 WP_003412381.1.68667 WP_003412381.1.68669 WP_003412381.1.68672 WP_003412381.1.68684 WP_003412381.1.68704 WP_003412381.1.68708 WP_003412381.1.6872 WP_003412381.1.68730 WP_003412381.1.68734 WP_003412381.1.68748 WP_003412381.1.68754 WP_003412381.1.6876 WP_003412381.1.68761 WP_003412381.1.68763 WP_003412381.1.68766 WP_003412381.1.68774 WP_003412381.1.68796 WP_003412381.1.68824 WP_003412381.1.68832 WP_003412381.1.68833 WP_003412381.1.68841 WP_003412381.1.68859 WP_003412381.1.68876 WP_003412381.1.68906 WP_003412381.1.68923 WP_003412381.1.68945 WP_003412381.1.6896 WP_003412381.1.68984 WP_003412381.1.68997 WP_003412381.1.69008 WP_003412381.1.69076 WP_003412381.1.69079 WP_003412381.1.6908 WP_003412381.1.69082 WP_003412381.1.69178 WP_003412381.1.69181 WP_003412381.1.69208 WP_003412381.1.69231 WP_003412381.1.69256 WP_003412381.1.69311 WP_003412381.1.69315 WP_003412381.1.69322 WP_003412381.1.69342 WP_003412381.1.6936 WP_003412381.1.69369 WP_003412381.1.69374 WP_003412381.1.69398 WP_003412381.1.69401 WP_003412381.1.69426 WP_003412381.1.69427 WP_003412381.1.69429 WP_003412381.1.6949 WP_003412381.1.6951 WP_003412381.1.69511 WP_003412381.1.69526 WP_003412381.1.69528 WP_003412381.1.69547 WP_003412381.1.69573 WP_003412381.1.69581 WP_003412381.1.6960 WP_003412381.1.69617 WP_003412381.1.69634 WP_003412381.1.69647 WP_003412381.1.69659 WP_003412381.1.69673 WP_003412381.1.69682 WP_003412381.1.69684 WP_003412381.1.69686 WP_003412381.1.69707 WP_003412381.1.69709 WP_003412381.1.69723 WP_003412381.1.69736 WP_003412381.1.69778 WP_003412381.1.69800 WP_003412381.1.69802 WP_003412381.1.69845 WP_003412381.1.69870 WP_003412381.1.69873 WP_003412381.1.69898 WP_003412381.1.69913 WP_003412381.1.69925 WP_003412381.1.69931 WP_003412381.1.69938 WP_003412381.1.69955 WP_003412381.1.69981 WP_003412381.1.69990 WP_003412381.1.70 WP_003412381.1.70000 WP_003412381.1.70017 WP_003412381.1.70032 WP_003412381.1.70055 WP_003412381.1.70062 WP_003412381.1.70072 WP_003412381.1.70131 WP_003412381.1.70132 WP_003412381.1.7022 WP_003412381.1.70227 WP_003412381.1.70255 WP_003412381.1.70271 WP_003412381.1.70274 WP_003412381.1.7029 WP_003412381.1.70325 WP_003412381.1.70328 WP_003412381.1.70356 WP_003412381.1.70364 WP_003412381.1.70368 WP_003412381.1.70369 WP_003412381.1.70418 WP_003412381.1.70422 WP_003412381.1.70435 WP_003412381.1.70444 WP_003412381.1.70463 WP_003412381.1.70471 WP_003412381.1.70480 WP_003412381.1.70494 WP_003412381.1.70498 WP_003412381.1.70505 WP_003412381.1.70525 WP_003412381.1.70573 WP_003412381.1.70577 WP_003412381.1.70610 WP_003412381.1.70615 WP_003412381.1.70618 WP_003412381.1.70622 WP_003412381.1.70626 WP_003412381.1.70668 WP_003412381.1.70699 WP_003412381.1.70704 WP_003412381.1.70729 WP_003412381.1.70757 WP_003412381.1.70782 WP_003412381.1.70796 WP_003412381.1.70830 WP_003412381.1.70834 WP_003412381.1.7084 WP_003412381.1.70840 WP_003412381.1.70864 WP_003412381.1.70871 WP_003412381.1.70915 WP_003412381.1.70955 WP_003412381.1.70958 WP_003412381.1.70964 WP_003412381.1.70976 WP_003412381.1.71015 WP_003412381.1.71026 WP_003412381.1.71063 WP_003412381.1.71076 WP_003412381.1.71083 WP_003412381.1.7111 WP_003412381.1.71118 WP_003412381.1.71128 WP_003412381.1.7113 WP_003412381.1.71187 WP_003412381.1.71191 WP_003412381.1.71258 WP_003412381.1.71289 WP_003412381.1.71326 WP_003412381.1.71329 WP_003412381.1.71331 WP_003412381.1.71344 WP_003412381.1.71390 WP_003412381.1.71399 WP_003412381.1.71414 WP_003412381.1.71457 WP_003412381.1.7146 WP_003412381.1.71464 WP_003412381.1.71490 WP_003412381.1.71492 WP_003412381.1.71509 WP_003412381.1.71516 WP_003412381.1.71517 WP_003412381.1.71527 WP_003412381.1.71532 WP_003412381.1.71545 WP_003412381.1.71546 WP_003412381.1.71569 WP_003412381.1.71604 WP_003412381.1.71621 WP_003412381.1.71630 WP_003412381.1.71654 WP_003412381.1.71664 WP_003412381.1.71665 WP_003412381.1.71701 WP_003412381.1.71718 WP_003412381.1.71731 WP_003412381.1.71778 WP_003412381.1.71781 WP_003412381.1.71803 WP_003412381.1.71820 WP_003412381.1.7185 WP_003412381.1.71851 WP_003412381.1.71871 WP_003412381.1.71909 WP_003412381.1.71957 WP_003412381.1.71970 WP_003412381.1.72047 WP_003412381.1.72061 WP_003412381.1.72072 WP_003412381.1.72111 WP_003412381.1.72122 WP_003412381.1.72128 WP_003412381.1.72143 WP_003412381.1.7216 WP_003412381.1.72168 WP_003412381.1.72179 WP_003412381.1.72209 WP_003412381.1.72218 WP_003412381.1.72219 WP_003412381.1.72227 WP_003412381.1.7224 WP_003412381.1.72268 WP_003412381.1.72332 WP_003412381.1.72380 WP_003412381.1.72401 WP_003412381.1.72405 WP_003412381.1.72420 WP_003412381.1.72441 WP_003412381.1.72451 WP_003412381.1.72452 WP_003412381.1.72457 WP_003412381.1.72459 WP_003412381.1.72460 WP_003412381.1.72466 WP_003412381.1.72487 WP_003412381.1.72488 WP_003412381.1.72492 WP_003412381.1.72506 WP_003412381.1.72543 WP_003412381.1.7256 WP_003412381.1.72576 WP_003412381.1.72578 WP_003412381.1.72585 WP_003412381.1.72591 WP_003412381.1.72592 WP_003412381.1.72640 WP_003412381.1.7266 WP_003412381.1.72661 WP_003412381.1.72684 WP_003412381.1.72739 WP_003412381.1.72744 WP_003412381.1.72755 WP_003412381.1.72759 WP_003412381.1.72784 WP_003412381.1.72792 WP_003412381.1.72826 WP_003412381.1.72852 WP_003412381.1.72853 WP_003412381.1.72879 WP_003412381.1.72938 WP_003412381.1.72954 WP_003412381.1.72957 WP_003412381.1.72959 WP_003412381.1.72973 WP_003412381.1.7298 WP_003412381.1.72982 WP_003412381.1.72988 WP_003412381.1.72993 WP_003412381.1.73006 WP_003412381.1.73013 WP_003412381.1.73025 WP_003412381.1.73028 WP_003412381.1.73042 WP_003412381.1.73045 WP_003412381.1.73092 WP_003412381.1.73118 WP_003412381.1.7312 WP_003412381.1.73127 WP_003412381.1.73134 WP_003412381.1.73150 WP_003412381.1.73154 WP_003412381.1.73163 WP_003412381.1.73182 WP_003412381.1.73205 WP_003412381.1.7321 WP_003412381.1.73310 WP_003412381.1.73365 WP_003412381.1.73391 WP_003412381.1.73404 WP_003412381.1.73424 WP_003412381.1.73436 WP_003412381.1.73465 WP_003412381.1.73466 WP_003412381.1.73470 WP_003412381.1.73471 WP_003412381.1.73478 WP_003412381.1.73482 WP_003412381.1.73507 WP_003412381.1.73532 WP_003412381.1.73550 WP_003412381.1.73564 WP_003412381.1.73623 WP_003412381.1.73629 WP_003412381.1.73644 WP_003412381.1.7366 WP_003412381.1.73661 WP_003412381.1.7368 WP_003412381.1.73688 WP_003412381.1.73723 WP_003412381.1.73744 WP_003412381.1.73750 WP_003412381.1.73760 WP_003412381.1.73774 WP_003412381.1.7379 WP_003412381.1.73813 WP_003412381.1.73840 WP_003412381.1.73876 WP_003412381.1.7389 WP_003412381.1.73986 WP_003412381.1.74016 WP_003412381.1.74039 WP_003412381.1.74083 WP_003412381.1.74101 WP_003412381.1.74107 WP_003412381.1.74120 WP_003412381.1.74144 WP_003412381.1.7417 WP_003412381.1.74190 WP_003412381.1.74210 WP_003412381.1.7423 WP_003412381.1.74262 WP_003412381.1.74269 WP_003412381.1.74282 WP_003412381.1.74291 WP_003412381.1.74296 WP_003412381.1.74304 WP_003412381.1.7432 WP_003412381.1.74347 WP_003412381.1.7436 WP_003412381.1.74378 WP_003412381.1.74382 WP_003412381.1.74395 WP_003412381.1.74400 WP_003412381.1.74401 WP_003412381.1.74432 WP_003412381.1.74442 WP_003412381.1.74477 WP_003412381.1.74487 WP_003412381.1.74499 WP_003412381.1.74504 WP_003412381.1.74511 WP_003412381.1.74523 WP_003412381.1.74525 WP_003412381.1.74551 WP_003412381.1.74555 WP_003412381.1.74628 WP_003412381.1.74641 WP_003412381.1.74653 WP_003412381.1.74660 WP_003412381.1.74683 WP_003412381.1.7469 WP_003412381.1.74725 WP_003412381.1.74760 WP_003412381.1.74786 WP_003412381.1.74809 WP_003412381.1.74820 WP_003412381.1.74870 WP_003412381.1.74881 WP_003412381.1.74888 WP_003412381.1.74952 WP_003412381.1.7496 WP_003412381.1.74988 WP_003412381.1.75043 WP_003412381.1.75045 WP_003412381.1.75078 WP_003412381.1.75081 WP_003412381.1.75120 WP_003412381.1.75163 WP_003412381.1.75188 WP_003412381.1.75200 WP_003412381.1.75202 WP_003412381.1.75234 WP_003412381.1.75239 WP_003412381.1.75250 WP_003412381.1.75263 WP_003412381.1.75281 WP_003412381.1.75342 WP_003412381.1.7535 WP_003412381.1.75376 WP_003412381.1.75391 WP_003412381.1.75395 WP_003412381.1.75441 WP_003412381.1.75510 WP_003412381.1.75581 WP_003412381.1.75598 WP_003412381.1.75635 WP_003412381.1.75645 WP_003412381.1.75665 WP_003412381.1.75671 WP_003412381.1.75749 WP_003412381.1.75772 WP_003412381.1.75774 WP_003412381.1.75811 WP_003412381.1.75833 WP_003412381.1.7585 WP_003412381.1.75864 WP_003412381.1.75868 WP_003412381.1.75878 WP_003412381.1.75927 WP_003412381.1.75946 WP_003412381.1.75968 WP_003412381.1.75974 WP_003412381.1.76007 WP_003412381.1.76016 WP_003412381.1.76032 WP_003412381.1.76037 WP_003412381.1.7604 WP_003412381.1.76045 WP_003412381.1.76052 WP_003412381.1.76058 WP_003412381.1.76064 WP_003412381.1.76110 WP_003412381.1.76126 WP_003412381.1.76133 WP_003412381.1.76138 WP_003412381.1.76157 WP_003412381.1.76172 WP_003412381.1.76177 WP_003412381.1.76183 WP_003412381.1.76239 WP_003412381.1.76277 WP_003412381.1.76280 WP_003412381.1.76281 WP_003412381.1.76291 WP_003412381.1.76297 WP_003412381.1.76360 WP_003412381.1.76379 WP_003412381.1.76403 WP_003412381.1.76413 WP_003412381.1.76414 WP_003412381.1.76427 WP_003412381.1.76436 WP_003412381.1.76442 WP_003412381.1.76443 WP_003412381.1.76456 WP_003412381.1.76521 WP_003412381.1.76533 WP_003412381.1.76616 WP_003412381.1.76625 WP_003412381.1.76629 WP_003412381.1.76635 WP_003412381.1.76638 WP_003412381.1.76639 WP_003412381.1.76640 WP_003412381.1.76644 WP_003412381.1.76677 WP_003412381.1.76678 WP_003412381.1.76734 WP_003412381.1.76744 WP_003412381.1.76750 WP_003412381.1.76754 WP_003412381.1.76757 WP_003412381.1.76781 WP_003412381.1.76818 WP_003412381.1.76824 WP_003412381.1.76835 WP_003412381.1.76873 WP_003412381.1.76881 WP_003412381.1.76888 WP_003412381.1.76900 WP_003412381.1.7691 WP_003412381.1.76947 WP_003412381.1.76954 WP_003412381.1.76955 WP_003412381.1.76963 WP_003412381.1.76976 WP_003412381.1.770 WP_003412381.1.77000 WP_003412381.1.77008 WP_003412381.1.77021 WP_003412381.1.77056 WP_003412381.1.77065 WP_003412381.1.77075 WP_003412381.1.77093 WP_003412381.1.77107 WP_003412381.1.77115 WP_003412381.1.77118 WP_003412381.1.77125 WP_003412381.1.77141 WP_003412381.1.77142 WP_003412381.1.77166 WP_003412381.1.77250 WP_003412381.1.77252 WP_003412381.1.77260 WP_003412381.1.77266 WP_003412381.1.77280 WP_003412381.1.77285 WP_003412381.1.77312 WP_003412381.1.77348 WP_003412381.1.77351 WP_003412381.1.77352 WP_003412381.1.77361 WP_003412381.1.774 WP_003412381.1.7740 WP_003412381.1.77404 WP_003412381.1.77425 WP_003412381.1.77463 WP_003412381.1.77474 WP_003412381.1.7748 WP_003412381.1.77484 WP_003412381.1.77491 WP_003412381.1.77499 WP_003412381.1.77510 WP_003412381.1.77530 WP_003412381.1.77554 WP_003412381.1.77559 WP_003412381.1.77599 WP_003412381.1.77605 WP_003412381.1.7762 WP_003412381.1.77627 WP_003412381.1.77649 WP_003412381.1.77654 WP_003412381.1.7766 WP_003412381.1.77667 WP_003412381.1.77704 WP_003412381.1.77706 WP_003412381.1.77726 WP_003412381.1.77774 WP_003412381.1.7778 WP_003412381.1.77790 WP_003412381.1.77809 WP_003412381.1.77820 WP_003412381.1.77843 WP_003412381.1.77855 WP_003412381.1.77865 WP_003412381.1.77868 WP_003412381.1.77879 WP_003412381.1.77890 WP_003412381.1.77909 WP_003412381.1.77911 WP_003412381.1.77931 WP_003412381.1.77984 WP_003412381.1.78020 WP_003412381.1.78024 WP_003412381.1.78075 WP_003412381.1.78084 WP_003412381.1.78086 WP_003412381.1.7809 WP_003412381.1.78098 WP_003412381.1.78105 WP_003412381.1.78113 WP_003412381.1.78136 WP_003412381.1.78162 WP_003412381.1.7817 WP_003412381.1.78200 WP_003412381.1.78216 WP_003412381.1.78236 WP_003412381.1.78238 WP_003412381.1.78322 WP_003412381.1.78338 WP_003412381.1.7836 WP_003412381.1.78360 WP_003412381.1.78386 WP_003412381.1.78429 WP_003412381.1.78435 WP_003412381.1.7844 WP_003412381.1.78459 WP_003412381.1.78488 WP_003412381.1.7849 WP_003412381.1.78499 WP_003412381.1.785 WP_003412381.1.78516 WP_003412381.1.78524 WP_003412381.1.78526 WP_003412381.1.78538 WP_003412381.1.78544 WP_003412381.1.78545 WP_003412381.1.78547 WP_003412381.1.78574 WP_003412381.1.78580 WP_003412381.1.7860 WP_003412381.1.78620 WP_003412381.1.78646 WP_003412381.1.78648 WP_003412381.1.78649 WP_003412381.1.78655 WP_003412381.1.78657 WP_003412381.1.78659 WP_003412381.1.7869 WP_003412381.1.78692 WP_003412381.1.78760 WP_003412381.1.78766 WP_003412381.1.78776 WP_003412381.1.78778 WP_003412381.1.78784 WP_003412381.1.78788 WP_003412381.1.78790 WP_003412381.1.78793 WP_003412381.1.78848 WP_003412381.1.78860 WP_003412381.1.7887 WP_003412381.1.78884 WP_003412381.1.78932 WP_003412381.1.78969 WP_003412381.1.78977 WP_003412381.1.78980 WP_003412381.1.79005 WP_003412381.1.79016 WP_003412381.1.79033 WP_003412381.1.79064 WP_003412381.1.79066 WP_003412381.1.79068 WP_003412381.1.79077 WP_003412381.1.79095 WP_003412381.1.79112 WP_003412381.1.79122 WP_003412381.1.79145 WP_003412381.1.79152 WP_003412381.1.79163 WP_003412381.1.79182 WP_003412381.1.79198 WP_003412381.1.79213 WP_003412381.1.79218 WP_003412381.1.79268 WP_003412381.1.79273 WP_003412381.1.79278 WP_003412381.1.79290 WP_003412381.1.79319 WP_003412381.1.79325 WP_003412381.1.79326 WP_003412381.1.79330 WP_003412381.1.79339 WP_003412381.1.79394 WP_003412381.1.79399 WP_003412381.1.79413 WP_003412381.1.79422 WP_003412381.1.79445 WP_003412381.1.79447 WP_003412381.1.79455 WP_003412381.1.79471 WP_003412381.1.79480 WP_003412381.1.79482 WP_003412381.1.79488 WP_003412381.1.79502 WP_003412381.1.79508 WP_003412381.1.79514 WP_003412381.1.79561 WP_003412381.1.79578 WP_003412381.1.79588 WP_003412381.1.79598 WP_003412381.1.79615 WP_003412381.1.79684 WP_003412381.1.79698 WP_003412381.1.797 WP_003412381.1.79744 WP_003412381.1.79784 WP_003412381.1.79802 WP_003412381.1.79806 WP_003412381.1.79819 WP_003412381.1.79826 WP_003412381.1.79828 WP_003412381.1.79851 WP_003412381.1.79853 WP_003412381.1.79863 WP_003412381.1.79881 WP_003412381.1.79885 WP_003412381.1.79898 WP_003412381.1.7990 WP_003412381.1.79900 WP_003412381.1.79913 WP_003412381.1.79918 WP_003412381.1.79947 WP_003412381.1.79948 WP_003412381.1.7997 WP_003412381.1.80004 WP_003412381.1.80015 WP_003412381.1.80022 WP_003412381.1.80030 WP_003412381.1.80054 WP_003412381.1.80084 WP_003412381.1.80099 WP_003412381.1.80129 WP_003412381.1.80177 WP_003412381.1.80234 WP_003412381.1.8026 WP_003412381.1.80275 WP_003412381.1.8029 WP_003412381.1.80299 WP_003412381.1.80300 WP_003412381.1.80304 WP_003412381.1.80326 WP_003412381.1.80351 WP_003412381.1.8037 WP_003412381.1.80370 WP_003412381.1.80399 WP_003412381.1.8044 WP_003412381.1.80451 WP_003412381.1.80458 WP_003412381.1.80461 WP_003412381.1.80490 WP_003412381.1.80503 WP_003412381.1.80507 WP_003412381.1.80552 WP_003412381.1.80576 WP_003412381.1.80588 WP_003412381.1.80599 WP_003412381.1.8060 WP_003412381.1.80636 WP_003412381.1.80669 WP_003412381.1.80673 WP_003412381.1.80711 WP_003412381.1.80714 WP_003412381.1.80743 WP_003412381.1.80784 WP_003412381.1.80815 WP_003412381.1.80853 WP_003412381.1.80918 WP_003412381.1.8093 WP_003412381.1.80967 WP_003412381.1.8097 WP_003412381.1.80988 WP_003412381.1.81007 WP_003412381.1.81013 WP_003412381.1.8105 WP_003412381.1.81059 WP_003412381.1.81063 WP_003412381.1.81066 WP_003412381.1.81075 WP_003412381.1.81091 WP_003412381.1.81119 WP_003412381.1.81125 WP_003412381.1.81136 WP_003412381.1.8114 WP_003412381.1.81189 WP_003412381.1.81192 WP_003412381.1.812 WP_003412381.1.81230 WP_003412381.1.81249 WP_003412381.1.81250 WP_003412381.1.81264 WP_003412381.1.8128 WP_003412381.1.81287 WP_003412381.1.81297 WP_003412381.1.8138 WP_003412381.1.81407 WP_003412381.1.8143 WP_003412381.1.81465 WP_003412381.1.81505 WP_003412381.1.81529 WP_003412381.1.81538 WP_003412381.1.81541 WP_003412381.1.81560 WP_003412381.1.81561 WP_003412381.1.81567 WP_003412381.1.81583 WP_003412381.1.81686 WP_003412381.1.81712 WP_003412381.1.81720 WP_003412381.1.81774 WP_003412381.1.81788 WP_003412381.1.81809 WP_003412381.1.81820 WP_003412381.1.81850 WP_003412381.1.81883 WP_003412381.1.81891 WP_003412381.1.81911 WP_003412381.1.81918 WP_003412381.1.82011 WP_003412381.1.82048 WP_003412381.1.82069 WP_003412381.1.82071 WP_003412381.1.82108 WP_003412381.1.82136 WP_003412381.1.82142 WP_003412381.1.8215 WP_003412381.1.82158 WP_003412381.1.8217 WP_003412381.1.82209 WP_003412381.1.82210 WP_003412381.1.82228 WP_003412381.1.82236 WP_003412381.1.82251 WP_003412381.1.82271 WP_003412381.1.82305 WP_003412381.1.82307 WP_003412381.1.82309 WP_003412381.1.82317 WP_003412381.1.8232 WP_003412381.1.82346 WP_003412381.1.82374 WP_003412381.1.82385 WP_003412381.1.82429 WP_003412381.1.82460 WP_003412381.1.82462 WP_003412381.1.82483 WP_003412381.1.82494 WP_003412381.1.82546 WP_003412381.1.82547 WP_003412381.1.82549 WP_003412381.1.82577 WP_003412381.1.82592 WP_003412381.1.82597 WP_003412381.1.82598 WP_003412381.1.82625 WP_003412381.1.82642 WP_003412381.1.82651 WP_003412381.1.82653 WP_003412381.1.82681 WP_003412381.1.82685 WP_003412381.1.8271 WP_003412381.1.82712 WP_003412381.1.8273 WP_003412381.1.82743 WP_003412381.1.82757 WP_003412381.1.82774 WP_003412381.1.82803 WP_003412381.1.82836 WP_003412381.1.82860 WP_003412381.1.82871 WP_003412381.1.82892 WP_003412381.1.82935 WP_003412381.1.82957 WP_003412381.1.82973 WP_003412381.1.82981 WP_003412381.1.82983 WP_003412381.1.83004 WP_003412381.1.83009 WP_003412381.1.83044 WP_003412381.1.83074 WP_003412381.1.83110 WP_003412381.1.83146 WP_003412381.1.83149 WP_003412381.1.83159 WP_003412381.1.8317 WP_003412381.1.83173 WP_003412381.1.83181 WP_003412381.1.83182 WP_003412381.1.83191 WP_003412381.1.83197 WP_003412381.1.83212 WP_003412381.1.8326 WP_003412381.1.83262 WP_003412381.1.83268 WP_003412381.1.83273 WP_003412381.1.83309 WP_003412381.1.83332 WP_003412381.1.83334 WP_003412381.1.83341 WP_003412381.1.83349 WP_003412381.1.8335 WP_003412381.1.83353 WP_003412381.1.83367 WP_003412381.1.83380 WP_003412381.1.83381 WP_003412381.1.83389 WP_003412381.1.83408 WP_003412381.1.83409 WP_003412381.1.83435 WP_003412381.1.83470 WP_003412381.1.83524 WP_003412381.1.83526 WP_003412381.1.8358 WP_003412381.1.83589 WP_003412381.1.83601 WP_003412381.1.83611 WP_003412381.1.83638 WP_003412381.1.83656 WP_003412381.1.83667 WP_003412381.1.83689 WP_003412381.1.83692 WP_003412381.1.83705 WP_003412381.1.83766 WP_003412381.1.83793 WP_003412381.1.83794 WP_003412381.1.83802 WP_003412381.1.83805 WP_003412381.1.83839 WP_003412381.1.83842 WP_003412381.1.83850 WP_003412381.1.83861 WP_003412381.1.83884 WP_003412381.1.83920 WP_003412381.1.83929 WP_003412381.1.83975 WP_003412381.1.83991 WP_003412381.1.8400 WP_003412381.1.84027 WP_003412381.1.8404 WP_003412381.1.84057 WP_003412381.1.84070 WP_003412381.1.8409 WP_003412381.1.84112 WP_003412381.1.84146 WP_003412381.1.8415 WP_003412381.1.84176 WP_003412381.1.84186 WP_003412381.1.84192 WP_003412381.1.84228 WP_003412381.1.8424 WP_003412381.1.84244 WP_003412381.1.84259 WP_003412381.1.8426 WP_003412381.1.84277 WP_003412381.1.84287 WP_003412381.1.8434 WP_003412381.1.84388 WP_003412381.1.84408 WP_003412381.1.84409 WP_003412381.1.84438 WP_003412381.1.84460 WP_003412381.1.84488 WP_003412381.1.84504 WP_003412381.1.84525 WP_003412381.1.84620 WP_003412381.1.84623 WP_003412381.1.84641 WP_003412381.1.84655 WP_003412381.1.84666 WP_003412381.1.84670 WP_003412381.1.84739 WP_003412381.1.84748 WP_003412381.1.84766 WP_003412381.1.84772 WP_003412381.1.84774 WP_003412381.1.848 WP_003412381.1.84812 WP_003412381.1.84836 WP_003412381.1.84839 WP_003412381.1.84846 WP_003412381.1.84873 WP_003412381.1.84911 WP_003412381.1.84938 WP_003412381.1.84968 WP_003412381.1.84973 WP_003412381.1.84981 WP_003412381.1.84985 WP_003412381.1.8503 WP_003412381.1.85038 WP_003412381.1.85041 WP_003412381.1.85043 WP_003412381.1.8505 WP_003412381.1.85074 WP_003412381.1.8509 WP_003412381.1.8512 WP_003412381.1.85148 WP_003412381.1.8518 WP_003412381.1.8522 WP_003412381.1.85242 WP_003412381.1.85276 WP_003412381.1.85281 WP_003412381.1.85284 WP_003412381.1.85314 WP_003412381.1.85319 WP_003412381.1.85330 WP_003412381.1.85341 WP_003412381.1.85346 WP_003412381.1.8535 WP_003412381.1.85363 WP_003412381.1.85371 WP_003412381.1.85377 WP_003412381.1.85387 WP_003412381.1.85399 WP_003412381.1.85458 WP_003412381.1.8546 WP_003412381.1.85464 WP_003412381.1.85478 WP_003412381.1.85480 WP_003412381.1.85488 WP_003412381.1.85495 WP_003412381.1.85551 WP_003412381.1.85557 WP_003412381.1.85577 WP_003412381.1.85597 WP_003412381.1.85599 WP_003412381.1.85610 WP_003412381.1.8563 WP_003412381.1.85648 WP_003412381.1.85679 WP_003412381.1.85704 WP_003412381.1.85717 WP_003412381.1.85727 WP_003412381.1.85763 WP_003412381.1.85808 WP_003412381.1.85819 WP_003412381.1.85820 WP_003412381.1.85823 WP_003412381.1.85832 WP_003412381.1.8586 WP_003412381.1.85872 WP_003412381.1.85894 WP_003412381.1.85909 WP_003412381.1.85913 WP_003412381.1.85953 WP_003412381.1.85986 WP_003412381.1.86000 WP_003412381.1.86024 WP_003412381.1.86025 WP_003412381.1.86032 WP_003412381.1.86048 WP_003412381.1.86052 WP_003412381.1.86067 WP_003412381.1.86103 WP_003412381.1.86122 WP_003412381.1.86124 WP_003412381.1.86160 WP_003412381.1.86164 WP_003412381.1.86168 WP_003412381.1.86204 WP_003412381.1.86235 WP_003412381.1.86249 WP_003412381.1.86260 WP_003412381.1.86290 WP_003412381.1.863 WP_003412381.1.86327 WP_003412381.1.86334 WP_003412381.1.86337 WP_003412381.1.86368 WP_003412381.1.86377 WP_003412381.1.86425 WP_003412381.1.86459 WP_003412381.1.8649 WP_003412381.1.86499 WP_003412381.1.86561 WP_003412381.1.86568 WP_003412381.1.86575 WP_003412381.1.86584 WP_003412381.1.86605 WP_003412381.1.86626 WP_003412381.1.86648 WP_003412381.1.8666 WP_003412381.1.86684 WP_003412381.1.86696 WP_003412381.1.86705 WP_003412381.1.86718 WP_003412381.1.86725 WP_003412381.1.86757 WP_003412381.1.86766 WP_003412381.1.86801 WP_003412381.1.86814 WP_003412381.1.86820 WP_003412381.1.86825 WP_003412381.1.86834 WP_003412381.1.8685 WP_003412381.1.86851 WP_003412381.1.86855 WP_003412381.1.86867 WP_003412381.1.86877 WP_003412381.1.86883 WP_003412381.1.8689 WP_003412381.1.86892 WP_003412381.1.86933 WP_003412381.1.86941 WP_003412381.1.86950 WP_003412381.1.86962 WP_003412381.1.86963 WP_003412381.1.86979 WP_003412381.1.8700 WP_003412381.1.87001 WP_003412381.1.87002 WP_003412381.1.87031 WP_003412381.1.87116 WP_003412381.1.87117 WP_003412381.1.8714 WP_003412381.1.87162 WP_003412381.1.87178 WP_003412381.1.87191 WP_003412381.1.87201 WP_003412381.1.87209 WP_003412381.1.87240 WP_003412381.1.87266 WP_003412381.1.87273 WP_003412381.1.87275 WP_003412381.1.8733 WP_003412381.1.87345 WP_003412381.1.87369 WP_003412381.1.8737 WP_003412381.1.87401 WP_003412381.1.87404 WP_003412381.1.87406 WP_003412381.1.87409 WP_003412381.1.87444 WP_003412381.1.87446 WP_003412381.1.87459 WP_003412381.1.87472 WP_003412381.1.87489 WP_003412381.1.87494 WP_003412381.1.87496 WP_003412381.1.87582 WP_003412381.1.87588 WP_003412381.1.87617 WP_003412381.1.87619 WP_003412381.1.87620 WP_003412381.1.87634 WP_003412381.1.87643 WP_003412381.1.8765 WP_003412381.1.87650 WP_003412381.1.87654 WP_003412381.1.87658 WP_003412381.1.87665 WP_003412381.1.87676 WP_003412381.1.87677 WP_003412381.1.87684 WP_003412381.1.87692 WP_003412381.1.87707 WP_003412381.1.87732 WP_003412381.1.87784 WP_003412381.1.87796 WP_003412381.1.87809 WP_003412381.1.87817 WP_003412381.1.87827 WP_003412381.1.87831 WP_003412381.1.87835 WP_003412381.1.87837 WP_003412381.1.87866 WP_003412381.1.8789 WP_003412381.1.87911 WP_003412381.1.87924 WP_003412381.1.87951 WP_003412381.1.87955 WP_003412381.1.87956 WP_003412381.1.87991 WP_003412381.1.88 WP_003412381.1.88002 WP_003412381.1.88037 WP_003412381.1.88039 WP_003412381.1.88072 WP_003412381.1.88077 WP_003412381.1.88121 WP_003412381.1.88180 WP_003412381.1.88191 WP_003412381.1.88205 WP_003412381.1.88217 WP_003412381.1.88219 WP_003412381.1.88245 WP_003412381.1.88253 WP_003412381.1.88294 WP_003412381.1.88315 WP_003412381.1.88316 WP_003412381.1.88320 WP_003412381.1.88338 WP_003412381.1.8840 WP_003412381.1.88437 WP_003412381.1.88453 WP_003412381.1.88489 WP_003412381.1.88521 WP_003412381.1.88530 WP_003412381.1.88537 WP_003412381.1.88592 WP_003412381.1.88616 WP_003412381.1.88618 WP_003412381.1.8862 WP_003412381.1.88625 WP_003412381.1.88632 WP_003412381.1.88634 WP_003412381.1.88649 WP_003412381.1.8870 WP_003412381.1.88737 WP_003412381.1.888 WP_003412381.1.88824 WP_003412381.1.88886 WP_003412381.1.88965 WP_003412381.1.88985 WP_003412381.1.8902 WP_003412381.1.89025 WP_003412381.1.89041 WP_003412381.1.89046 WP_003412381.1.89082 WP_003412381.1.89162 WP_003412381.1.89168 WP_003412381.1.8917 WP_003412381.1.89193 WP_003412381.1.89205 WP_003412381.1.89225 WP_003412381.1.8925 WP_003412381.1.89277 WP_003412381.1.89286 WP_003412381.1.89293 WP_003412381.1.89320 WP_003412381.1.8935 WP_003412381.1.89371 WP_003412381.1.89378 WP_003412381.1.89406 WP_003412381.1.8943 WP_003412381.1.89451 WP_003412381.1.89453 WP_003412381.1.89473 WP_003412381.1.89475 WP_003412381.1.89483 WP_003412381.1.895 WP_003412381.1.89513 WP_003412381.1.89517 WP_003412381.1.89522 WP_003412381.1.8954 WP_003412381.1.89543 WP_003412381.1.89567 WP_003412381.1.8957 WP_003412381.1.89572 WP_003412381.1.89589 WP_003412381.1.89607 WP_003412381.1.89613 WP_003412381.1.89625 WP_003412381.1.89648 WP_003412381.1.8967 WP_003412381.1.89670 WP_003412381.1.89676 WP_003412381.1.89729 WP_003412381.1.89739 WP_003412381.1.89762 WP_003412381.1.8977 WP_003412381.1.89802 WP_003412381.1.89808 WP_003412381.1.8982 WP_003412381.1.89829 WP_003412381.1.89831 WP_003412381.1.89844 WP_003412381.1.89849 WP_003412381.1.89903 WP_003412381.1.89909 WP_003412381.1.89922 WP_003412381.1.89926 WP_003412381.1.89963 WP_003412381.1.89971 WP_003412381.1.8998 WP_003412381.1.89987 WP_003412381.1.900 WP_003412381.1.90048 WP_003412381.1.9007 WP_003412381.1.90080 WP_003412381.1.90130 WP_003412381.1.90134 WP_003412381.1.90137 WP_003412381.1.90157 WP_003412381.1.90184 WP_003412381.1.90199 WP_003412381.1.90231 WP_003412381.1.90245 WP_003412381.1.90308 WP_003412381.1.90322 WP_003412381.1.90328 WP_003412381.1.90372 WP_003412381.1.90439 WP_003412381.1.90481 WP_003412381.1.90499 WP_003412381.1.9050 WP_003412381.1.90527 WP_003412381.1.90550 WP_003412381.1.90560 WP_003412381.1.90612 WP_003412381.1.90640 WP_003412381.1.90672 WP_003412381.1.90691 WP_003412381.1.90711 WP_003412381.1.90722 WP_003412381.1.9075 WP_003412381.1.90756 WP_003412381.1.90767 WP_003412381.1.90771 WP_003412381.1.90785 WP_003412381.1.90788 WP_003412381.1.90800 WP_003412381.1.90810 WP_003412381.1.90816 WP_003412381.1.90819 WP_003412381.1.9082 WP_003412381.1.90831 WP_003412381.1.90884 WP_003412381.1.90899 WP_003412381.1.90906 WP_003412381.1.90958 WP_003412381.1.90976 WP_003412381.1.90987 WP_003412381.1.9102 WP_003412381.1.91026 WP_003412381.1.91032 WP_003412381.1.91043 WP_003412381.1.91053 WP_003412381.1.91106 WP_003412381.1.91112 WP_003412381.1.91144 WP_003412381.1.91151 WP_003412381.1.91157 WP_003412381.1.91167 WP_003412381.1.91169 WP_003412381.1.91192 WP_003412381.1.91201 WP_003412381.1.91207 WP_003412381.1.91208 WP_003412381.1.91211 WP_003412381.1.91214 WP_003412381.1.91230 WP_003412381.1.91244 WP_003412381.1.91251 WP_003412381.1.91260 WP_003412381.1.91265 WP_003412381.1.9128 WP_003412381.1.91284 WP_003412381.1.91294 WP_003412381.1.91303 WP_003412381.1.91322 WP_003412381.1.91352 WP_003412381.1.91386 WP_003412381.1.9139 WP_003412381.1.91398 WP_003412381.1.91411 WP_003412381.1.91430 WP_003412381.1.91436 WP_003412381.1.91483 WP_003412381.1.91496 WP_003412381.1.91508 WP_003412381.1.91576 WP_003412381.1.91589 WP_003412381.1.91694 WP_003412381.1.91695 WP_003412381.1.91716 WP_003412381.1.91717 WP_003412381.1.91728 WP_003412381.1.91743 WP_003412381.1.91759 WP_003412381.1.91784 WP_003412381.1.91785 WP_003412381.1.91786 WP_003412381.1.91802 WP_003412381.1.91822 WP_003412381.1.91828 WP_003412381.1.9189 WP_003412381.1.91896 WP_003412381.1.9190 WP_003412381.1.91915 WP_003412381.1.91937 WP_003412381.1.91944 WP_003412381.1.91953 WP_003412381.1.91957 WP_003412381.1.91976 WP_003412381.1.91978 WP_003412381.1.92021 WP_003412381.1.92083 WP_003412381.1.92127 WP_003412381.1.92144 WP_003412381.1.92150 WP_003412381.1.92153 WP_003412381.1.92190 WP_003412381.1.92192 WP_003412381.1.92200 WP_003412381.1.92220 WP_003412381.1.92221 WP_003412381.1.92222 WP_003412381.1.92289 WP_003412381.1.9229 WP_003412381.1.92294 WP_003412381.1.92300 WP_003412381.1.92317 WP_003412381.1.92334 WP_003412381.1.92338 WP_003412381.1.92345 WP_003412381.1.92356 WP_003412381.1.92364 WP_003412381.1.92380 WP_003412381.1.92416 WP_003412381.1.92428 WP_003412381.1.92447 WP_003412381.1.92456 WP_003412381.1.92467 WP_003412381.1.92471 WP_003412381.1.92490 WP_003412381.1.92508 WP_003412381.1.9251 WP_003412381.1.92511 WP_003412381.1.92523 WP_003412381.1.92536 WP_003412381.1.92592 WP_003412381.1.92603 WP_003412381.1.92606 WP_003412381.1.92610 WP_003412381.1.92613 WP_003412381.1.9265 WP_003412381.1.92650 WP_003412381.1.92660 WP_003412381.1.92677 WP_003412381.1.92685 WP_003412381.1.92689 WP_003412381.1.92690 WP_003412381.1.92706 WP_003412381.1.92714 WP_003412381.1.92736 WP_003412381.1.9274 WP_003412381.1.92752 WP_003412381.1.92760 WP_003412381.1.92777 WP_003412381.1.92803 WP_003412381.1.92856 WP_003412381.1.92892 WP_003412381.1.92907 WP_003412381.1.92908 WP_003412381.1.9291 WP_003412381.1.92917 WP_003412381.1.92996 WP_003412381.1.93006 WP_003412381.1.93008 WP_003412381.1.93009 WP_003412381.1.93015 WP_003412381.1.93043 WP_003412381.1.9307 WP_003412381.1.93083 WP_003412381.1.93097 WP_003412381.1.93137 WP_003412381.1.93192 WP_003412381.1.93203 WP_003412381.1.93212 WP_003412381.1.93234 WP_003412381.1.93245 WP_003412381.1.93257 WP_003412381.1.93265 WP_003412381.1.93297 WP_003412381.1.93320 WP_003412381.1.93328 WP_003412381.1.93337 WP_003412381.1.93343 WP_003412381.1.93349 WP_003412381.1.93363 WP_003412381.1.93377 WP_003412381.1.9338 WP_003412381.1.93407 WP_003412381.1.93417 WP_003412381.1.93419 WP_003412381.1.93426 WP_003412381.1.9344 WP_003412381.1.93443 WP_003412381.1.93447 WP_003412381.1.93470 WP_003412381.1.93483 WP_003412381.1.93487 WP_003412381.1.93495 WP_003412381.1.93499 WP_003412381.1.93516 WP_003412381.1.93536 WP_003412381.1.93544 WP_003412381.1.93555 WP_003412381.1.93560 WP_003412381.1.93564 WP_003412381.1.9357 WP_003412381.1.93573 WP_003412381.1.93576 WP_003412381.1.93588 WP_003412381.1.9363 WP_003412381.1.93645 WP_003412381.1.93649 WP_003412381.1.93659 WP_003412381.1.93677 WP_003412381.1.9368 WP_003412381.1.93689 WP_003412381.1.93693 WP_003412381.1.93698 WP_003412381.1.93706 WP_003412381.1.9371 WP_003412381.1.93792 WP_003412381.1.93823 WP_003412381.1.93871 WP_003412381.1.9388 WP_003412381.1.93894 WP_003412381.1.93903 WP_003412381.1.93907 WP_003412381.1.93913 WP_003412381.1.93946 WP_003412381.1.93950 WP_003412381.1.93953 WP_003412381.1.93954 WP_003412381.1.93988 WP_003412381.1.9407 WP_003412381.1.94143 WP_003412381.1.94154 WP_003412381.1.94184 WP_003412381.1.94204 WP_003412381.1.94205 WP_003412381.1.94226 WP_003412381.1.94231 WP_003412381.1.94256 WP_003412381.1.94261 WP_003412381.1.94281 WP_003412381.1.94292 WP_003412381.1.94297 WP_003412381.1.9431 WP_003412381.1.94326 WP_003412381.1.94339 WP_003412381.1.94392 WP_003412381.1.94416 WP_003412381.1.94421 WP_003412381.1.94456 WP_003412381.1.94470 WP_003412381.1.94480 WP_003412381.1.94495 WP_003412381.1.94511 WP_003412381.1.94512 WP_003412381.1.94525 WP_003412381.1.94528 WP_003412381.1.94564 WP_003412381.1.946 WP_003412381.1.94602 WP_003412381.1.94623 WP_003412381.1.94629 WP_003412381.1.9465 WP_003412381.1.94673 WP_003412381.1.94714 WP_003412381.1.94730 WP_003412381.1.94736 WP_003412381.1.94776 WP_003412381.1.9478 WP_003412381.1.94834 WP_003412381.1.94852 WP_003412381.1.94872 WP_003412381.1.9488 WP_003412381.1.94902 WP_003412381.1.94916 WP_003412381.1.94979 WP_003412381.1.94994 WP_003412381.1.94996 WP_003412381.1.94998 WP_003412381.1.95007 WP_003412381.1.95015 WP_003412381.1.95034 WP_003412381.1.95068 WP_003412381.1.95081 WP_003412381.1.95082 WP_003412381.1.9509 WP_003412381.1.95096 WP_003412381.1.95112 WP_003412381.1.95138 WP_003412381.1.9514 WP_003412381.1.95179 WP_003412381.1.95188 WP_003412381.1.95190 WP_003412381.1.95234 WP_003412381.1.95241 WP_003412381.1.95245 WP_003412381.1.95257 WP_003412381.1.9531 WP_003412381.1.95335 WP_003412381.1.95344 WP_003412381.1.9535 WP_003412381.1.95370 WP_003412381.1.95392 WP_003412381.1.95416 WP_003412381.1.95417 WP_003412381.1.95455 WP_003412381.1.95491 WP_003412381.1.95497 WP_003412381.1.95508 WP_003412381.1.95509 WP_003412381.1.95529 WP_003412381.1.95556 WP_003412381.1.95557 WP_003412381.1.95565 WP_003412381.1.95578 WP_003412381.1.95580 WP_003412381.1.95585 WP_003412381.1.95643 WP_003412381.1.95679 WP_003412381.1.95685 WP_003412381.1.957 WP_003412381.1.95724 WP_003412381.1.95727 WP_003412381.1.95730 WP_003412381.1.95735 WP_003412381.1.95758 WP_003412381.1.95772 WP_003412381.1.95797 WP_003412381.1.95839 WP_003412381.1.9585 WP_003412381.1.9590 WP_003412381.1.95902 WP_003412381.1.95908 WP_003412381.1.95924 WP_003412381.1.95926 WP_003412381.1.95953 WP_003412381.1.95958 WP_003412381.1.95964 WP_003412381.1.95973 WP_003412381.1.96006 WP_003412381.1.9602 WP_003412381.1.96036 WP_003412381.1.96062 WP_003412381.1.96065 WP_003412381.1.96098 WP_003412381.1.96146 WP_003412381.1.96166 WP_003412381.1.96171 WP_003412381.1.96182 WP_003412381.1.96204 WP_003412381.1.96230 WP_003412381.1.96235 WP_003412381.1.96242 WP_003412381.1.96245 WP_003412381.1.96254 WP_003412381.1.96259 WP_003412381.1.96286 WP_003412381.1.96313 WP_003412381.1.96318 WP_003412381.1.96345 WP_003412381.1.96360 WP_003412381.1.96456 WP_003412381.1.96486 WP_003412381.1.96560 WP_003412381.1.96569 WP_003412381.1.96573 WP_003412381.1.96575 WP_003412381.1.96576 WP_003412381.1.96611 WP_003412381.1.96621 WP_003412381.1.9667 WP_003412381.1.96681 WP_003412381.1.96726 WP_003412381.1.96733 WP_003412381.1.96742 WP_003412381.1.96754 WP_003412381.1.9678 WP_003412381.1.96832 WP_003412381.1.9685 WP_003412381.1.97008 WP_003412381.1.97009 WP_003412381.1.97056 WP_003412381.1.97084 WP_003412381.1.97087 WP_003412381.1.97094 WP_003412381.1.97096 WP_003412381.1.97099 WP_003412381.1.97108 WP_003412381.1.97113 WP_003412381.1.97122 WP_003412381.1.97127 WP_003412381.1.97129 WP_003412381.1.97136 WP_003412381.1.9716 WP_003412381.1.97176 WP_003412381.1.97222 WP_003412381.1.97223 WP_003412381.1.97237 WP_003412381.1.97242 WP_003412381.1.97270 WP_003412381.1.97296 WP_003412381.1.97321 WP_003412381.1.97325 WP_003412381.1.97330 WP_003412381.1.97366 WP_003412381.1.97376 WP_003412381.1.97380 WP_003412381.1.9739 WP_003412381.1.97462 WP_003412381.1.97517 WP_003412381.1.97519 WP_003412381.1.97535 WP_003412381.1.97540 WP_003412381.1.97545 WP_003412381.1.97546 WP_003412381.1.97550 WP_003412381.1.97577 WP_003412381.1.97584 WP_003412381.1.9759 WP_003412381.1.97591 WP_003412381.1.97596 WP_003412381.1.97609 WP_003412381.1.97618 WP_003412381.1.9763 WP_003412381.1.97669 WP_003412381.1.97673 WP_003412381.1.97700 WP_003412381.1.97701 WP_003412381.1.9773 WP_003412381.1.97740 WP_003412381.1.97754 WP_003412381.1.97797 WP_003412381.1.9782 WP_003412381.1.9784 WP_003412381.1.97888 WP_003412381.1.9790 WP_003412381.1.9795 WP_003412381.1.97951 WP_003412381.1.97958 WP_003412381.1.97966 WP_003412381.1.97977 WP_003412381.1.97979 WP_003412381.1.97995 WP_003412381.1.98018 WP_003412381.1.98034 WP_003412381.1.98052 WP_003412381.1.98071 WP_003412381.1.98072 WP_003412381.1.98113 WP_003412381.1.98114 WP_003412381.1.98128 WP_003412381.1.98181 WP_003412381.1.98188 WP_003412381.1.98189 WP_003412381.1.98213 WP_003412381.1.98225 WP_003412381.1.98291 WP_003412381.1.98335 WP_003412381.1.98350 WP_003412381.1.98395 WP_003412381.1.98412 WP_003412381.1.98441 WP_003412381.1.98443 WP_003412381.1.98462 WP_003412381.1.9848 WP_003412381.1.98482 WP_003412381.1.98486 WP_003412381.1.98488 WP_003412381.1.98503 WP_003412381.1.98516 WP_003412381.1.98524 WP_003412381.1.98536 WP_003412381.1.98541 WP_003412381.1.98566 WP_003412381.1.98576 WP_003412381.1.98590 WP_003412381.1.98594 WP_003412381.1.98599 WP_003412381.1.98629 WP_003412381.1.98645 WP_003412381.1.98646 WP_003412381.1.98649 WP_003412381.1.98656 WP_003412381.1.9867 WP_003412381.1.98674 WP_003412381.1.98697 WP_003412381.1.98701 WP_003412381.1.98739 WP_003412381.1.98749 WP_003412381.1.98765 WP_003412381.1.98770 WP_003412381.1.98777 WP_003412381.1.98778 WP_003412381.1.98802 WP_003412381.1.98838 WP_003412381.1.98850 WP_003412381.1.98906 WP_003412381.1.98935 WP_003412381.1.98948 WP_003412381.1.98953 WP_003412381.1.98984 WP_003412381.1.99000 WP_003412381.1.99023 WP_003412381.1.99030 WP_003412381.1.99037 WP_003412381.1.99055 WP_003412381.1.99062 WP_003412381.1.99086 WP_003412381.1.99115 WP_003412381.1.99117 WP_003412381.1.99161 WP_003412381.1.99176 WP_003412381.1.99205 WP_003412381.1.99211 WP_003412381.1.99216 WP_003412381.1.99222 WP_003412381.1.99251 WP_003412381.1.99269 WP_003412381.1.99294 WP_003412381.1.99312 WP_003412381.1.99315 WP_003412381.1.99322 WP_003412381.1.99328 WP_003412381.1.99365 WP_003412381.1.99368 WP_003412381.1.99379 WP_003412381.1.99396 WP_003412381.1.99402 WP_003412381.1.99404 WP_003412381.1.99419 WP_003412381.1.99438 WP_003412381.1.99460 WP_003412381.1.99468 WP_003412381.1.99473 WP_003412381.1.99513 WP_003412381.1.99529 WP_003412381.1.99548 WP_003412381.1.99572 WP_003412381.1.99578 WP_003412381.1.99605 WP_003412381.1.99609 WP_003412381.1.99617 WP_003412381.1.99635 WP_003412381.1.99650 WP_003412381.1.99672 WP_003412381.1.99701 WP_003412381.1.99711 WP_003412381.1.99716 WP_003412381.1.99740 WP_003412381.1.99745 WP_003412381.1.99749 WP_003412381.1.99798 WP_003412381.1.99817 WP_003412381.1.99832 WP_003412381.1.99847 WP_003412381.1.99852 WP_003412381.1.99886 WP_003412381.1.99897 WP_003412381.1.99899 WP_003412381.1.99915 WP_003412381.1.9993 WP_003412381.1.99982 WP_003412381.1.99991 gi|15841936|ref|NP_336973.1| gi|471338413|ref|YP_007611126.1| gi|31793596|ref|NP_856089.1| gi|433627547|ref|YP_007261176.1| gi|340627428|ref|YP_004745880.1| gi|392431975|ref|YP_006473019.1| gi|385999198|ref|YP_005917497.1| gi|479056380|ref|YP_007352186.1| gi|494700853|ref|YP_007966335.1| gi|197741009|ref|YP_002162323.1| gi|392387058|ref|YP_005308687.1| gi|15609554|ref|NP_216933.1| gi|479315363|ref|YP_007855415.1| 233413.Mb2440c 336982.TBFG_12445 410289.BCG_2433c 419947.MRA_2443 561275.JTY_2427 83331.MT2490 83332.Rv2417c gi|506926947|ref|YP_008007397.1| gi|378772150|ref|YP_005171883.1| gi|375295768|ref|YP_005100035.1| gi|224990792|ref|YP_002645479.1| gi|525674993|ref|YP_008226510.1| gi|506926947|ref|YP_008007397.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]