SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225863071|ref|YP_002748449.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225863071|ref|YP_002748449.1|
Domain Number 1 Region: 133-300
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.09e-31
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.023
Further Details:      
 
Domain Number 2 Region: 58-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000103
Family AraC type transcriptional activator 0.0024
Further Details:      
 
Domain Number 3 Region: 7-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000197
Family AraC type transcriptional activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225863071|ref|YP_002748449.1|
Sequence length 300
Comment transcriptional regulator, AraC family [Bacillus cereus 03BB102]
Sequence
MESYETQIQRSIDYIEEDVMEKQTLRKLARIAGFSESHFHRVFQALVGDTVMEYVRKRRL
ARAAYQLSHTDEKIIDIAFEHGFQSHETFTRAFKKLFQMTPSEYRKQEIETPMYYSVNVK
QRKLNPYLGGIQMEYRIVNKPEFLMAGYELKTTSKEGKNHQDIPAFWQEYLQKDLGTTIP
NRKDTSQWVELGLCTDFNLETGDFTYIIGMEVTDFENVPNEIAKRTFPAATYAVFTTPKV
PHEEMVSSIHQTWNAVFSEWFPHSGYEHCGVTEFELYDERCHEDKSEFAQVELWIPVKKK
Download sequence
Identical sequences A0A0U0DRY7 A0A158RUL2
572264.BCA_1160 WP_000446817.1.2569 WP_000446817.1.34158 WP_000446817.1.44483 WP_000446817.1.45385 WP_000446817.1.94373 gi|225863071|ref|YP_002748449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]