SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225863387|ref|YP_002748765.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225863387|ref|YP_002748765.1|
Domain Number 1 Region: 135-293
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.85e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000516
Further Details:      
 
Domain Number 2 Region: 388-526
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 14-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.71e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00071
Further Details:      
 
Domain Number 4 Region: 270-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225863387|ref|YP_002748765.1|
Sequence length 540
Comment putative sulfite reductase [Bacillus cereus 03BB102]
Sequence
MSYEKVWANNEKLNQTEKNKLKKDGLEIFNDIPYYAENGFESIPKEEWDAFKWAGLYLQR
PKEAGYFMMRVNIPSGIITNAQAEVLASIAEDYGRDVIDITTRQAIQFHWLEIHQIPDIF
KRLARVGLSSAGACGDITRNITGNPLAGIDANELFDTTHIVKEVYDYFQHNEEFSNLPRK
FKMSISSNIYNAANAEINCVAFTPATKEIDGEKKVGFHIKVGGGLSARPYLADELDVFVL
PEEVKAVAIAIATIFRDFGYREKRHLARLKFLVADWGAEKFKEKLIEYTGPLQSKGESAL
KGWNAGYFYGVQDQKQEGLKYVGFNVPVGRLHAEEMFEIARIAKQYGNGQIRTCNSQNFI
IPNVPPENVTGLLTEPLFEAISANPKSFIGHAVSCTGIEYCNLALVETKERLRKIAEYLD
TQIALDVPVRIHMVGCPNSCGQRQIADIGLQGVKMKTKEKGIVEAFEIYVGGTLLDGGAY
NQKLKGKIDGEDLPDVLASFISYFKENKLPAETFYDFVGRVGVETLQIALNNVLEEVIAS
Download sequence
Identical sequences A0A0K6LCD9 A0A0K6MI70 A0A154B3F5 A0A158RU52 A0A1T3V8P3 A0A242W0N1 A0A243BDP6 A0A243CSZ2 A0RBN5 B7JGQ6 C2TE06
gi|218902632|ref|YP_002450466.1| 405535.BCAH820_1515 412694.BALH_1279 572264.BCA_1481 gi|225863387|ref|YP_002748765.1| WP_000119642.1.100409 WP_000119642.1.12289 WP_000119642.1.14882 WP_000119642.1.15163 WP_000119642.1.16013 WP_000119642.1.16156 WP_000119642.1.20865 WP_000119642.1.2569 WP_000119642.1.29804 WP_000119642.1.30216 WP_000119642.1.33536 WP_000119642.1.33828 WP_000119642.1.34158 WP_000119642.1.41365 WP_000119642.1.44483 WP_000119642.1.45385 WP_000119642.1.45919 WP_000119642.1.46476 WP_000119642.1.4649 WP_000119642.1.46549 WP_000119642.1.4865 WP_000119642.1.53879 WP_000119642.1.55968 WP_000119642.1.56318 WP_000119642.1.59173 WP_000119642.1.62300 WP_000119642.1.63137 WP_000119642.1.63611 WP_000119642.1.64491 WP_000119642.1.66331 WP_000119642.1.67239 WP_000119642.1.7096 WP_000119642.1.7545 WP_000119642.1.7856 WP_000119642.1.85901 WP_000119642.1.90596 WP_000119642.1.93893 WP_000119642.1.94373 WP_000119642.1.95308 gi|118476984|ref|YP_894135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]