SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225863569|ref|YP_002748947.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225863569|ref|YP_002748947.1|
Domain Number 1 Region: 124-273
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.46e-42
Family Multidrug-binding domain of transcription activator BmrR 0.028
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 6.23e-25
Family DNA-binding N-terminal domain of transcription activators 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225863569|ref|YP_002748947.1|
Sequence length 276
Comment transcriptional regulator, MerR family [Bacillus cereus 03BB102]
Sequence
MLLNKRFTIGEMAKMHNIAESTLRYYDEKGIFHPSTVDPQTNYRYYTIDQFSLLDTIKFL
RQLNIPLKEIKKYIDERNPAYALNLLEKQQEMMLKKQREIEYALAKMEHRIHLIKEATKA
KAEQMVIKEIPQRKITAIAVAPNTTDDMFEYYIHSLQKNMRQMDDSLFSGDIGVTVAKKG
LMQNEFQAYSSVFILLDYMPFEVQSSDEIKEGLYACSYHHGPYEETGATYKELLAYIDQE
GYEVSGDAIEIGLIDWSVTENPEEQVTEIQIPVVKK
Download sequence
Identical sequences A0A158RJ40 A0A1T2Q375 A0RC49 C2NFL5
gi|376265548|ref|YP_005118260.1| WP_000925949.1.24676 WP_000925949.1.2569 WP_000925949.1.33828 WP_000925949.1.3699 WP_000925949.1.44483 WP_000925949.1.46476 WP_000925949.1.74337 gi|225863569|ref|YP_002748947.1| 412694.BALH_1452 572264.BCA_1671 gi|118477148|ref|YP_894299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]