SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225864556|ref|YP_002749934.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225864556|ref|YP_002749934.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.22e-24
Family DNA-binding N-terminal domain of transcription activators 0.0009
Further Details:      
 
Domain Number 2 Region: 119-269
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.49e-18
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225864556|ref|YP_002749934.1|
Sequence length 269
Comment transcriptional regulator, MerR family [Bacillus cereus 03BB102]
Sequence
MFKIGDFSKLSSISIRMLRHYDKVELLQPIKVDEQSGYRYYSAAQLKKVNQIQTLKNMGF
NIATIKEIIECDNIDGIKEQFLNRSAQIKEDMTNLKKQLRLLEDSMKTMREDVVEMNYHV
SIKEIPERYVASVRKVIPSYNCEGDLWTMLMQEIHIKNISMAHPSYSIAVFHDQEYKEND
VDVEIQLNILGKHENTKDVYFQKIEPIKVASVTVSGSYEQMTNVNEAAAKWIETEGYELA
GPMFNIYHVSPAMESDPNKWVTEVCYPVK
Download sequence
Identical sequences A0A158RN74 A0REH2 B3ZB88 B3ZJQ0
gi|376266503|ref|YP_005119215.1| gi|118477971|ref|YP_895122.1| gi|225864556|ref|YP_002749934.1| 412694.BALH_2317 572264.BCA_2661 WP_000472604.1.13221 WP_000472604.1.23873 WP_000472604.1.2569 WP_000472604.1.26000 WP_000472604.1.33828 WP_000472604.1.3699 WP_000472604.1.41365 WP_000472604.1.44483 WP_000472604.1.46476 WP_000472604.1.4649 WP_000472604.1.782 WP_000472604.1.9269 WP_000472604.1.97149 WP_000472604.1.99454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]