SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225864708|ref|YP_002750086.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225864708|ref|YP_002750086.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.88e-27
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225864708|ref|YP_002750086.1|
Sequence length 159
Comment hypothetical protein BCA_2815 [Bacillus cereus 03BB102]
Sequence
MKVVVKELRPLEVAFIRRTGSYFEPQDHWGKLLNWSIKNKLYPLEQSFIGISLDNPELVA
SHMCRHDACVTIPKNFEKEQHEDVQFKSVDGGLYALYQFYDEPHKLSEVYRYMYAVWLPN
SEYSADYDRDNLEFCMNNVAEDLEGKLKVDLFVPIKKNK
Download sequence
Identical sequences A0A158RPC0 A0REV1 B3ZK48 C2NII8
412694.BALH_2455 572264.BCA_2815 gi|118478100|ref|YP_895251.1| gi|225864708|ref|YP_002750086.1| gi|376266598|ref|YP_005119310.1| WP_000869975.1.13221 WP_000869975.1.23873 WP_000869975.1.24676 WP_000869975.1.2569 WP_000869975.1.26000 WP_000869975.1.33828 WP_000869975.1.3699 WP_000869975.1.44483 WP_000869975.1.46476 WP_000869975.1.4649 WP_000869975.1.62300 WP_000869975.1.782 WP_000869975.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]