SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225866834|ref|YP_002752212.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225866834|ref|YP_002752212.1|
Domain Number 1 Region: 128-290
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.6e-31
Family Rob transcription factor, C-terminal domain 0.078
Further Details:      
 
Domain Number 2 Region: 57-112
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000206
Family AraC type transcriptional activator 0.0081
Further Details:      
 
Domain Number 3 Region: 6-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000116
Family AraC type transcriptional activator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225866834|ref|YP_002752212.1|
Sequence length 290
Comment transcriptional regulator, AraC family [Bacillus cereus 03BB102]
Sequence
MDSLKNMNAAMQYIEDNLTHEIDFKEVAKIAYCSEYHFKRMFSFLAGISLSEYIRCRRLT
LAAFELKNSGAKVIDVAIKYGYNSPDSFSRAFQNLHGITPSEARSSSHSLKAYSPMTFQL
SIQGGHEMNYRIEEKDSFQIIGITKRVPIVFNGVNEEIASMWKSLNPETIQTLKSLSNME
PTGIISASTNFSEGRMEEKGELDHYIGVATTKDCPEQFKQLEVAASTWAIFEAVGPFPET
LQNVWGRIYSEWFPSSNYELAEGPEILWNEQKDISSPNFKSEIWIPVLKK
Download sequence
Identical sequences A0A158RL60 B3ZLA3
gi|376268768|ref|YP_005121480.1| WP_000377695.1.13221 WP_000377695.1.23873 WP_000377695.1.2569 WP_000377695.1.26000 WP_000377695.1.33828 WP_000377695.1.3699 WP_000377695.1.44483 WP_000377695.1.46476 WP_000377695.1.4649 WP_000377695.1.69323 WP_000377695.1.782 WP_000377695.1.9269 gi|225866834|ref|YP_002752212.1| 572264.BCA_4970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]