SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222475136|ref|YP_002563552.1| from Anaplasma marginale str. Florida

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222475136|ref|YP_002563552.1|
Domain Number 1 Region: 532-1031
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-130
Family ALDH-like 0.000000358
Further Details:      
 
Domain Number 2 Region: 179-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-103
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000231
Further Details:      
 
Domain Number 3 Region: 9-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.49e-59
Family N-terminal domain of bifunctional PutA protein 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222475136|ref|YP_002563552.1|
Sequence length 1047
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Anaplasma marginale str. Florida]
Sequence
MMISPLQSPDELRKRMQGLYNADEKSYVRYLTERTEVSQESKVRIYSLAKQIIEKVRANK
NTTIIDAFMQQYGLSTEEGLALMCLAESLLRIPDDCTIDDMIRDKIARTTWNKHIGRSTS
IFVNVSTLALSIGAHMLREVDDSRWYGILGNLLKDMGEPVIRKAALQAMQVLGKHYVCGR
TIEEAIARSYDAGHVCSFDVLGEAAKTRADADKYFAAYMGALETLGSNAQAVDDLGSRHG
ISVKLSSLHPRYEFGQADYVLKDISSKLLELCQVAKKYNVKLTVDAEEARRLELSLMILD
TVFSDSSLNGWEGLGFVIQAYQKRALAAIDFVEDIAIRANRKMIIRLVKGAYWDYEIRNA
QEMGLDGYPVFTRKVYTDVSYFACVQKLLSKPGTFYPVFGTHNAHSVSFILEMTDKDHPG
FEFQRLHGMAQDLYDYVTKEVAPNVCCRVYTPIGQHQELLPYLMRRLIENGANVSFVNMI
NDSDIPAECLCADPLEKAQSFEYAPHPYIPLPADMFPDGRVNSAGVNTSDSLTMLALSEE
VSAFNDTHWKAYPIIGGQDITEGELYEVFFPASLSTKVGEVLFATAEHAAQSIEAARSSF
YRWSNTPVGERAAILEHAADLLEKERGKFFSLLVREGGKVISDVIAEIREAVDFLRYYAM
LARDQLTDPIKLPGPAGEENYLYFESRGTFVCISPWNFPLAIFLGPIAAALVTGNTVIAK
PAEQTSLVAYEAVKLLYEAGVPTDVLHFVPGRGEVLGNALLSSANIAGVAFTGSTETANI
INQAIAGRGRDIIPLIAETGGINAMVVDSSALPEQVVEDVITSAFKSAGQRCSSLRVLFL
QEEIADKTIEMLLGAVAELRLGNPMALSTDIGPVIDQQSFDMLTSYVEEMRKKKIKLLCK
ADISYLSGEEEGYFFPPHIFELESMSQLSREVFGPVLHVIRYKKSDLPSILDDINSTGYG
LTFAIQSRIQSSIDDITDRIGAGNVYVNRNQVGAVVGVQPFGGRGLSGTGPKAGGPHYLH
RFLTEKTVTVNTAALGGSVSLTCLEDE
Download sequence
Identical sequences B9KII4
gi|557237738|ref|YP_008769470.1| gi|56416773|ref|YP_153847.1| gi|557625649|ref|YP_008786005.1| 234826.AM583 320483.AMF_435 gi|222475136|ref|YP_002563552.1| WP_010267585.1.19914 WP_010267585.1.23764 WP_010267585.1.27627 WP_010267585.1.77589 WP_010267585.1.78219 WP_010267585.1.83909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]