SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256823874|ref|YP_003147836.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256823874|ref|YP_003147836.1|
Domain Number - Region: 19-117
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0144
Family Helical scaffold and wing domains of SecA 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256823874|ref|YP_003147836.1|
Sequence length 133
Comment hypothetical protein Cyan8802_4620 [Cyanothece sp. PCC 8802]
Sequence
MPTIKIQAQLSKEDLFQAVQQLSLSELEGFVQDIIALKAKQKAPSLSTDETELLLKINQG
LSSDIQTRYQLLIQKRNDETLTEPEYQELLQLTDKVELHQAQRLDYLAQLAQLRQISLTD
LMTQLGIKPTIND
Download sequence
Identical sequences 395962.Cyan8802_4620 WP_012801494.1.62203 gi|256823874|ref|YP_003147836.1|NC_013167 gi|256823874|ref|YP_003147836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]