SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058001|ref|YP_003135889.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058001|ref|YP_003135889.1|
Domain Number 1 Region: 14-256
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 6.8e-63
Family YjeF N-terminal domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 238-516
Classification Level Classification E-value
Superfamily Ribokinase-like 5.38e-56
Family YjeF C-terminal domain-like 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058001|ref|YP_003135889.1|
Sequence length 524
Comment carbohydrate kinase [Cyanothece sp. PCC 8802]
Sequence
MMKLDAFDPLESIVVTADQMGKIESRLFEAGMPVAALMEKAALLMSRRIQELYPLSNLSR
VGILVGPGHNGGDALVIARELHLQGYNVCLYRPFIQSKELTNQHLKYAQSLGIPYSQEIE
FLDNCELIIDGLFGFGLTREISGHIDQAIEFINHLNIPIISVDIPSGLNTDTGKILGIAI
KATYTLCLGLWKPVFFQDQALEYLGKVERINFGIPPKDVWAIVSKPAPLQILTPTLAQRF
LPLPRPLVTHKYQQGHLLLICGSRRYAGGSILTGLGARSSGVGMLSIAVPESLKPLLVSH
LPDALIIDCPETDNGAIAELPPLAADFNNYDIIACGPGLTQEVTSVVEKVLKANCPVILD
ADALNILAKLGTMDSLSQRKATTILTPHLGEFKRLFPNIFDPGCDRIAAVRTAAQDTGAI
ILLKGARTAIATPNGSVWLISDSTPALARGGSGDVLTGLIGGLLAQKTASGGKIQTGVDV
GGIVATAAWWHAQAGILAAKERTELGVDAFTLSQWLVKVGTLPK
Download sequence
Identical sequences 395962.Cyan8802_0083 WP_012796619.1.62203 gi|257058001|ref|YP_003135889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]