SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058032|ref|YP_003135920.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058032|ref|YP_003135920.1|
Domain Number 1 Region: 470-978
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-160
Family ALDH-like 0.000000000839
Further Details:      
 
Domain Number 2 Region: 129-456
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.61e-96
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058032|ref|YP_003135920.1|
Sequence length 991
Comment delta-1-pyrroline-5-carboxylate dehydrogenase [Cyanothece sp. PCC 8802]
Sequence
MVTQIDANSYENKTQSIARELITQTREKRSLWDKIGDQMRLDDKLMGWAMANPGLRVQLF
HFIDTLPALRSNAEIAHHLQQYLGVESVELPSALKGILNFTDYQSAPAQLAAATVSKSVE
TLAFKYIAGETVQQVIKAVEKLRKEKMAFSIDLLGEAVITESEAKAYFQKYLDLMEELSQ
QSQKWSKVPEIDEADGEALPKVQVSVKLTAFYSQFDPIDPEGSKDKVCAFIRVLLRRAQE
LGVAVHFDMEQYVYKDLTLSILKELLLEEEFLTRTDIGVTLQAYLRDSQQDLHDLIAWAK
QRGYPITIRLVKGAYWDQETIKASQNHWPQPVFNDKAATDINFEQMTQILLENHQYLYAA
IGSHNVRSQAKAIAIAQTLNVPRRAFEMQVLYGMGDQLAKALVKQGYRVRVYAPYGNLLP
GMAYLIRRLLENTANSSFLRQNLEERPVEELIAPPIVKGETEMKEAQKVTFVNAPDTDYS
REVLRERAQKALAKVKDSLGKTYLPLINGEYVQTDVIIDSVNPCNPSEIVGHIGLMSIEQ
AEQALNTAKTAFPAWKKTPATERAKILRKAADLMEERRHELSAWVCLEVGKILQQADAEV
SEAIDFCRYYAAEMERLDAGYIYDIAGETNRYHYQPRGIALVISPWNFPMAIATGMTVAA
LVAGNCTLLKPAETSSVIAAKMVEILVEAGIPKGVIQYVPGKGSQVGAYMVNHPDVHLIA
FTGSREVGCRIYADAAILQPGQKHLKRVIAEMGGKNAIIVDESADLDQAVAGSVFSAFGY
SGQKCSAASRIIVLDPVYEAFLERFVEATRSLNIGPTDHPSTQVGPVIDATAQKRIQEYI
EIGKQQSTLALQMESPENGYFVGPTIFSNVSPSDTIAQEEIFGPVVAVIRVKNFDEALAV
ANGTDYALTGGLYSRSPEHIERAQNEFEVGNLYINRTITGAIVARQPFGGFKLSGVGSKA
GGPDYLLQFLEPRHITENIQRQGFAPIEGNE
Download sequence
Identical sequences 395962.Cyan8802_0114 WP_012796640.1.62203 gi|257058032|ref|YP_003135920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]