SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058041|ref|YP_003135929.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058041|ref|YP_003135929.1|
Domain Number 1 Region: 60-335
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.89e-69
Family Alanine racemase-like, N-terminal domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 309-469
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.51e-53
Family Eukaryotic ODC-like 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058041|ref|YP_003135929.1|
Sequence length 474
Comment diaminopimelate decarboxylase [Cyanothece sp. PCC 8802]
Sequence
MLSTEPRTSHSGQDYLDTNPLEQVQRSPNQSLLPLTATVNKQDRLEIGGCDLQTLVKQFG
SPLYVLDEATLRTACRQYREAFNTYYQGTSQVIYASKAWSCLAIVSIVASEGLGFDVVSG
GELHTTIKALEAMGWSTEQIAQQIYFHGNNKSHQELIFAIEIGCTIIVDNWLELETLVKL
GNQTGTLSIPILLRLTPGIECHTHEYIRTGHLDSKFGFDPNQLDAVFTYVSQQPTLDCRG
LHAHIGSQIFERQPHQDLGLVMVEWLKKAQNHGLVLQELNIGGGLGIRYVESDDPPSIEQ
WVKTVSESVMKACEIHQLPLPKLIAEPGRSLVGPACVTAYTIGSRKEIPQLRTYIAVDGG
MSDNPRPITYQSRYRTVVANRMSEPCTETVTIAGKHCESGDILIKDAQLPQTQPGDILVV
MATGAYNHSMASNYNRLPRPAAVLVQEGEANLIVQRETYEDLLRQDRLPQRLLS
Download sequence
Identical sequences B7K1S5
395962.Cyan8802_0123 41431.PCC8801_0126 gi|218245017|ref|YP_002370388.1| gi|257058041|ref|YP_003135929.1| WP_012593509.1.62203 WP_012593509.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]