SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058043|ref|YP_003135931.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058043|ref|YP_003135931.1|
Domain Number 1 Region: 19-243
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.24e-91
Family Undecaprenyl diphosphate synthase 0.000000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058043|ref|YP_003135931.1|
Sequence length 249
Comment undecaprenyl pyrophosphate synthase [Cyanothece sp. PCC 8802]
Sequence
MTVKPIVLNDLPTDLDYLRLPNHVAVIMDGNGRWAKRRGLPRIMGHQRGVDTLKDLLRCC
KDWGVPALTAYAFSTENWGRPLDEVEFLMTLFERVLRRELREMMEENVRIRFVGNLAVLP
PSLQEEIARSMQDTQNNTGIDFTVATNYGGRQEIVQACQAIATQVQQGLLNPEDIDESVF
EGHLYTKGIAHPDLLIRTSGEMRLSNFLLWQLAYAEIYVTQTLWPDFNREEFHQALLAYQ
QRERRFGKI
Download sequence
Identical sequences 395962.Cyan8802_0125 gi|257058043|ref|YP_003135931.1| WP_012796646.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]