SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058047|ref|YP_003135935.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058047|ref|YP_003135935.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.67e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00034
Further Details:      
 
Domain Number 2 Region: 143-234
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.51e-29
Family Middle domain of MutM-like DNA repair proteins 0.002
Further Details:      
 
Domain Number 3 Region: 231-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.84e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058047|ref|YP_003135935.1|
Sequence length 282
Comment formamidopyrimidine-DNA glycosylase [Cyanothece sp. PCC 8802]
Sequence
MPELPEVETVRRGLNQFTSGKIIEDAEILLTRSLAYPTSVDEFLSSIRGVSFGEWQRRGK
YLLGTLVKGSGEAAGWLGVHLRMTGQLLWVNQSEPLQTHTRLRLFCGENQELRFVDIRTF
GKVWWVPPKETPQRVITGLKKLGVEPFSDEFSVDYFTTKLKGRQRNIKTLLLDQEIVAGL
GNIYADEVLFKSGVHPTTLGKNLKPQQIEQLRIAIIEVLETAIVHGGTTFSDFKGVTGIN
GNYGGTAWVYGRTGEPCRVCGTSIERLKLGGRSAHFCPRCQA
Download sequence
Identical sequences gi|257058047|ref|YP_003135935.1| 395962.Cyan8802_0129 WP_012796649.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]