SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058136|ref|YP_003136024.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058136|ref|YP_003136024.1|
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily L28p-like 2.59e-25
Family Ribosomal protein L31p 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058136|ref|YP_003136024.1|
Sequence length 82
Comment 50S ribosomal protein L31 [Cyanothece sp. PCC 8802]
Sequence
MPKADIHPTWYPEAKIICNGEVVMTVGSTQPEIHVEVWSGNHPFYTGTQKMIDTEGRIDR
FQKRYGNLGKGGSKPNKKGDQK
Download sequence
Identical sequences B7K219
gi|257058136|ref|YP_003136024.1| 395962.Cyan8802_0220 41431.PCC8801_0223 WP_012593603.1.62203 WP_012593603.1.93053 gi|218245111|ref|YP_002370482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]