SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058149|ref|YP_003136037.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058149|ref|YP_003136037.1|
Domain Number 1 Region: 87-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.8e-23
Family Translational machinery components 0.00042
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.72e-19
Family Ribosomal S5 protein, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058149|ref|YP_003136037.1|
Sequence length 173
Comment 30S ribosomal protein S5 [Cyanothece sp. PCC 8802]
Sequence
MAKRRKGSRTKAKETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNENGQVGVGVGKAG
DVIGAVRKGVADGKKQLIDVSLTKASSITHITRGVSGGAKVIVRPAAPGTGVIAGGAVRT
VLELAGVKNILAKQLGSSNPLNNARAVINALEGLRTFSEVAQERGVPLEHLYT
Download sequence
Identical sequences gi|257058149|ref|YP_003136037.1| 395962.Cyan8802_0233 WP_012796700.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]