SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058151|ref|YP_003136039.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058151|ref|YP_003136039.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.04e-33
Family Ribosomal protein L6 0.000068
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.64e-26
Family Ribosomal protein L6 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058151|ref|YP_003136039.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Cyanothece sp. PCC 8802]
Sequence
MSRIGKRPIPIPNKVTIDIQGQHVAVKGPKGSLERTLPDKVNVVQENDTLLVQREDDSRT
ARERHGLTRTLVANMVEGVSKGFEKRLSIQGVGYRAQVQGTKLTLNVGYSKPVEMTMPAG
IQVAVENNTLVIVSGIDKEIVGNVSAEIRAVRPPEVYKGKGIRYSDEFVRRKAGKTGKK
Download sequence
Identical sequences B7K234
gi|257058151|ref|YP_003136039.1| WP_012593618.1.62203 WP_012593618.1.93053 395962.Cyan8802_0235 41431.PCC8801_0238 gi|218245126|ref|YP_002370497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]