SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058159|ref|YP_003136047.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058159|ref|YP_003136047.1|
Domain Number 1 Region: 111-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.7e-39
Family Ribosomal protein S3 C-terminal domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 8.9e-36
Family Prokaryotic type KH domain (KH-domain type II) 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058159|ref|YP_003136047.1|
Sequence length 241
Comment 30S ribosomal protein S3 [Cyanothece sp. PCC 8802]
Sequence
MGQKIHPIGFRLGITADHKSCWYADSKRYPETLQEDRQIRQYITKNLSNAGISDIRIERK
ADQVDLAIHTARPGVVVGRGGSGIEQLRLGLQQDLGGNRQIRINVIEVQRVDADAMLIAE
YITQQLERRVSFRRVVRQAIQRAQRAEVKGIKIQVSGRLNGAEIARTEWVREGRVPLHTL
RADIDYAYRTAQTIYGILGVKVWVFKGEIIPGQEEIPMPVPSQTPRRQRRRQQFEDRSGE
E
Download sequence
Identical sequences B7K329
WP_012593626.1.62203 WP_012593626.1.93053 395962.Cyan8802_0243 41431.PCC8801_0246 gi|218245134|ref|YP_002370505.1| gi|257058159|ref|YP_003136047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]