SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058189|ref|YP_003136077.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058189|ref|YP_003136077.1|
Domain Number 1 Region: 411-608
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.09e-74
Family FtsH protease domain-like 0.00000215
Further Details:      
 
Domain Number 2 Region: 157-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-73
Family Extended AAA-ATPase domain 0.0000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058189|ref|YP_003136077.1|
Sequence length 616
Comment ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Sequence
MSKNNKKWRNAGLYALLLIVVLALASAFFDQQPQSREPLTYTEFINQVENNQITRVSLSA
DRAEARVPNPNGGAPLVVNLPNDPDLINILTKHNVDISVQPQTDEGLWFRVASSLFLPIL
LLVGLFLLLRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGDVAGIEQAKLELAEVVDFL
KNADRFTAIGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGAS
RVRDLFEQAKANAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGI
IIIAATNRPDVLDAALLRPGRFDRQVVVDRPDYAGRQEILKVHARGKTLSKDIDLDKIAR
RTPGFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLV
AYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAV
ALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLGPVALGRQNGNVFLG
RDIASDRDFSDETAAAIDEEVRQLVDQAYKRAKDVLVNNRHILDKLAQMLVEKETVDADE
LQEILTSNEVKMAALA
Download sequence
Identical sequences B7K358
395962.Cyan8802_0278 41431.PCC8801_0278 gi|218245163|ref|YP_002370534.1| gi|257058189|ref|YP_003136077.1| WP_012593655.1.62203 WP_012593655.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]