SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058271|ref|YP_003136159.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058271|ref|YP_003136159.1|
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.21e-79
Family SAICAR synthase 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058271|ref|YP_003136159.1|
Sequence length 243
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Cyanothece sp. PCC 8802]
Sequence
MEKLYEGKAKILYTTEDPEILLTQFKDDATAFNALKRGTIQGKGEINCAISSALFQWLGT
KGITTHFIDQPAPTQMRVRAVKIIPLEVVVRNIAAGSLCRQTGLPEGKILPFPLVEFYLK
NDELGDPLLTRDRLLILELATAEQLEQLQTLAQQINQYLREFFATCQITLVDFKLEFGLD
SQGKLLLADEISPDTCRLWDQQKNDPQERVLDKDRFRRDLGEVESAYQQVQQRVLAQLGI
EAT
Download sequence
Identical sequences WP_012796765.1.62203 gi|257058271|ref|YP_003136159.1| 395962.Cyan8802_0363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]