SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058369|ref|YP_003136257.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058369|ref|YP_003136257.1|
Domain Number 1 Region: 183-643
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.12e-120
Family Amylase, catalytic domain 0.0000000048
Further Details:      
 
Domain Number 2 Region: 651-753
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.39e-35
Family alpha-Amylases, C-terminal beta-sheet domain 0.00037
Further Details:      
 
Domain Number 3 Region: 14-118
Classification Level Classification E-value
Superfamily E set domains 4.8e-17
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 141-198
Classification Level Classification E-value
Superfamily E set domains 0.0000000588
Family E-set domains of sugar-utilizing enzymes 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058369|ref|YP_003136257.1|
Sequence length 782
Comment glycogen branching protein [Cyanothece sp. PCC 8802]
Sequence
MTTTISPEQVHQIVNNLHHDPFEVLGCHLLDNKSTPTQWVVRAYLPQATAAWVLCPTERQ
EYEMRSVHHPHFFECIIETPQLNNYQLRLKEGENERFIYDPYAFASPNLTDFDLHLFAEG
NHHRIYEKLGAHPDEVEGVKGVYFALWAPNARNVSILGDFNQWDGRLHQMRKRLNNVWEL
FIPEIGVGTCYKYEVKNWEGHIYQKSDPYGFYQEVRPNFGSIVTDLDTYQWHDADWMQKR
RQSQPLNDPISIYEVHLGSWLHASSEEKTSLLNGESDPVIVSEEWNTGARFLSYYELAHK
LIPYVKELGYTHLELLPIAEHPFDGSWGYQVTGYYAPTSRYGTPEDFMYFVDQCHQNGLG
VIIDWVPAHFPKDAHGLAYFDGTHLYEHADPRKGEHKEWGTLIFNYGRNEVRNFLVANVL
FWFDKYHIDGIRVDAVASMLYLDYARKEGEWIPNQYGGRENLEAADFLRQMNTILYSYFP
GVLSIAEESTDWPMVSWPTYAGGLGFNFKWNMGWMHDILDYFSMDPWFRQFHQNNVTFSM
WYHHNENFMLALSHDEVVHGKSSILGKMPGDEWQKYANVRALFTYMFAHPGKKTMFMGME
FGQWGEWNVWGDLEWNLLQYEPHQQLKQFFTELNALYQSEPAFYERDFEQEGFHWIDCND
TSHSVVSFIRRAKNPNDFIIAVCNFTPQPHSHYRIGVPEAGFYTELFNSDAKKYGGSNLG
NLGGKYTDEWTFHNLPYSVDLCLPPLAVLILKLNRTKLNSILTLDIHSSELEDDSLSLKP
NS
Download sequence
Identical sequences 395962.Cyan8802_0465 gi|257058369|ref|YP_003136257.1| WP_012796812.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]