SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058395|ref|YP_003136283.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058395|ref|YP_003136283.1|
Domain Number 1 Region: 4-292
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.44e-102
Family Tyrosine-dependent oxidoreductases 0.000000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058395|ref|YP_003136283.1|
Sequence length 296
Comment dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 8802]
Sequence
MSKKILVTGIDGQVGQELKKTLNPLGEVIGVNRQTIDLTKPDRLRQLIQEIHPNIIINGA
AYTAVDQAEKEPELALAVNGIAPTIIAEEAHKLGAFLLHISTDYVFDGTKNIPYTEEDPT
HPVSVYGQSKLAGEQGIQKHSDRYVILRTAWVYGSYGKSNFVKTMLRLGQEREQIRVVSD
QIGSPTWAQDIAQTINQLLLTLDLKNTAEIYHFTNSGVASWYDFAVTIFEEAQNIGFPLK
VQQVDPITTADYPTPAKRPSYSVLSGQKITATLGKYPPYWRNSLKQMLEQLYHYSL
Download sequence
Identical sequences WP_015783152.1.62203 395962.Cyan8802_0492 gi|257058395|ref|YP_003136283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]