SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058399|ref|YP_003136287.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058399|ref|YP_003136287.1|
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000051
Family Rho termination factor, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058399|ref|YP_003136287.1|
Sequence length 387
Comment Rho termination factor domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MVPKQTPLEEMTLRQLRRVASQYNISRYSRMRKEQLITALRQAMREETVPYPSTVEGEQA
IEAAKFDVGQEDVIGGLLSSVDDQLGDLPDGYGDSRIVLLPRDPQWAYAYWDVPNEAKEA
LRQQGGKQLALRLYDVTHIDLNYHRPHSVQEYVCDESVREWYIPIPVSDRHYLLDIGYRC
FDGRWLILARSAPVRIPSVYPSDWVEDIFITVDWNEDLQGKTLCHLVSPGQTGDGSFIYD
DIFALGDSVFGSIPHIAGSLVSSYIFPSGVGSWAFPTESGLNMSGLGLSASGVPEQPRKF
WLVADAELIVYGATEPDAIVTIGGHPIKLNPDGTFRFQMSFQDGLIDYPIVALASDGEQS
RSIHMKFTRETPDRQTNSKEEAVLEWP
Download sequence
Identical sequences B7JVK8
WP_012593856.1.62203 WP_012593856.1.93053 gi|218245364|ref|YP_002370735.1| gi|257058399|ref|YP_003136287.1| 395962.Cyan8802_0496 41431.PCC8801_0483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]