SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058437|ref|YP_003136325.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058437|ref|YP_003136325.1|
Domain Number 1 Region: 117-462
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.33e-92
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000862
Further Details:      
 
Domain Number 2 Region: 463-585
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 4.51e-36
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00052
Further Details:      
 
Domain Number 3 Region: 2-107
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 3.14e-22
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058437|ref|YP_003136325.1|
Sequence length 585
Comment arginyl-tRNA synthetase [Cyanothece sp. PCC 8802]
Sequence
MTSINEQLTNYFSQALVKAFGAEFSDIDPIVVPASNPKFGDYQANIALSLAKKLGEQPRA
IAQKIIDNLSLEDLGELPTIAGPGFINIKIKPTYLATQLKVQQNSSSLGVTKADPIEKII
VDFSSPNIAKEMHVGHLRSTIIGDCIARILEVRGHQVLRLNHVGDWGTQFGMLIAYLAEV
YPDALTTADALDIGDLVTFYKQAKKRFDEDEKFQETARNQVVKLQAGDSQTRHAWQLLCE
QSRREFQVIYDILDINITERGESFYNPLLEDIVKELDHQGLLKKDAGAQCVFLDGFTNKS
GDPLPLIVQKSDGGYNYATTDLAALKYRITQDQAERIIYVTDAGQANHFAQVFQVAKKAH
IIPKNVEIIHVPFGLVKGEDGKKLKTRSGTTIKLRDLLDEAVIYARQDLEKRLAEEGRQE
SEDFIANVSQVVGISAVKYADLSQNRTSDYIFSYDKMLALQGNTAPYMLYAYARIQSISR
EGNIDFESLQQEAKIILQEETEIELGKYLLQLSEVIEEVEKTLLPNRLCDYLYELSKKFN
RFYENCPVLKSEEPLRTSRLLLCDLTARTLKLGLSLLGIPVLERM
Download sequence
Identical sequences WP_015783175.1.62203 395962.Cyan8802_0542 gi|257058437|ref|YP_003136325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]