SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058556|ref|YP_003136444.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058556|ref|YP_003136444.1|
Domain Number 1 Region: 139-579
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.14e-123
Family Amylase, catalytic domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 10-146
Classification Level Classification E-value
Superfamily E set domains 2.02e-43
Family E-set domains of sugar-utilizing enzymes 0.0035
Further Details:      
 
Domain Number 3 Region: 590-690
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.16e-23
Family alpha-Amylases, C-terminal beta-sheet domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058556|ref|YP_003136444.1|
Sequence length 694
Comment glycogen debranching protein GlgX [Cyanothece sp. PCC 8802]
Sequence
MIRNRIPSPTHPLGATVSPDGVNFCIFSKHATSIELLLFDEPNAPQPSKTIKLDRKTNRI
HYYWHIFVPGLKAGQVYAYRVHGPYEPQNGHRFDPSKVLLDPYGKAIVGSSIYNRDAAAR
PGDNCAQALRSVVVDNSTYNWEGDQPLNTPYSETIIYEMHVGGFTRHPNSGTPEEKRGTF
AGLIEKIPYLKSLGITAVELLPVHYFDPEDCPPGLTNYWGYSTINFFTPHRSYSSDKSPL
GPINEFRDMVKALHREGIEVILDVVFNHTAEGDDRGPTLSFRGIDNATYYILEDKDLSGY
TNYSGCGNTFRGNHPIVARLILESLHYWVSEMHVDGFRFDLASILTRDTSGHPIKDRQAL
DLLWVIESDPILAGTKLIAEAWDAAGLYDVGRFVELADWFAEWNGPFRDDVRRFVRAEPG
IVGKLAARILGSPDIYHRTEIDINRSINFVTCHDGFSLADLVSYNQKHNEANRENNRDGS
NDNFSWNCGVEGETENPQIRALRLQQIKNFLTILFISQGTPMILMGDEVARTRKGNNNVY
CQDNELSWFDWDDVERQFDLWCFLRKIIHFTQGLQLFRQEERLVVGSSHNHPHITWHGAI
LGKPDWSTESRQLAFSLSHPEANEYLHVILNAHWEGLDFELPPLNHDKCWHRIIDTALPL
SKSFCELDAADPISDNKYYVHGRASVVLMVKPRS
Download sequence
Identical sequences B7JXH7
gi|218245519|ref|YP_002370890.1| 395962.Cyan8802_0667 41431.PCC8801_0647 gi|257058556|ref|YP_003136444.1| WP_012594010.1.62203 WP_012594010.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]