SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058592|ref|YP_003136480.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058592|ref|YP_003136480.1|
Domain Number 1 Region: 8-198,346-573
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.53e-132
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000592
Further Details:      
 
Domain Number 2 Region: 602-859
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.92e-75
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000387
Further Details:      
 
Domain Number 3 Region: 197-347
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.83e-64
Family ValRS/IleRS/LeuRS editing domain 0.0000189
Further Details:      
 
Domain Number 4 Region: 844-908
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000000000267
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058592|ref|YP_003136480.1|
Sequence length 909
Comment valyl-tRNA synthetase [Cyanothece sp. PCC 8802]
Sequence
MTANVPELPTQYDPKTTEAKWQEAWETHQVFKADTNHPGTPYSIVIPPPNVTGSLHMGHA
FEDCLMDVLVRYHRMCGHNTLCLPGTDHASIAVHTILDRQLKAEGKTRYDIGREKFLEKA
WQWKEESGGTIVNQLKRMGLSADWSRERFTLDEGLSKAVRKAFIQLYEAGLIYRGNYLVN
WCPASLSAVSDLEVESKEVDGHLWHFRYPLTDGTGYIEVATTRPETMLGDTGVAVNPNDK
RYQNLIGKTLTLPLVGREIPIFADDLVDPEFGTGCVKVTPAHDPNDFEMGNRHNLPFINI
MNKDGTLNENAGIFQGQDRYVARKNVVKKLEEEGYLIKVEEYRHAVPYSDRGKVPVEPLL
STQWFVKIEPLSKKALTFLDEYNSPRFVPDRWTKVYRDWLIKLKDWCISRQLWWGHQIPA
WYVISETNNEITDHTPFIVADNEDEAIKKAQEQYGENITLEQDPDVLDTWFSSGLWPFST
LGWPENTEDLTRYYPTSTLVTGFDIIFFWVARMTMMAGYFTDQIPFKDVYIHGLVRDENG
KKMSKSANNGIDPLILIENYGTDALRYTLIKEVAGAGQDISLQYNRKTDESESVEASRNF
ANKLWNAARFVMMNLQGNTPKTLGVPDREKLELCDRWILSRFHQLVQQTRNYVENYGLGE
AAKGLYEFIWGDFCDWYIELVKTRLWKDSNTESRLVAQQTLAYVLDNTLRLLHPFMPHIT
EEIWQTLTQTSDQFLTLQAYPIADTQAIDPQLETSFDLIIATIRTLRNLRAEAEIKPGVK
VSVILQSENEHERAILESAQPYIKDLSKVEQLTITPQLEAEIGQVIAGVVGTVQALIPLS
GIIDIANLRGKLEKNLAKIEAEIKSLSSRLSNPGFVNKAPQEIIQGAQESLAEAQKQAEI
LRERLHRLK
Download sequence
Identical sequences WP_015783263.1.62203 395962.Cyan8802_0705 gi|257058592|ref|YP_003136480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]