SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058600|ref|YP_003136488.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058600|ref|YP_003136488.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.18e-83
Family Histidine biosynthesis enzymes 0.0000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058600|ref|YP_003136488.1|
Sequence length 256
Comment imidazole glycerol phosphate synthase subunit HisF [Cyanothece sp. PCC 8802]
Sequence
MLAKRILPCLDVNAGRVVKGVNFVNLQDAGDPVELAKIYNDAGADELVFLDITATHEGRD
TIIDVVYRTAEAVFIPLTVGGGIQTLDHIKNLLRAGADKISINSSAVRNPNFVNQASDRF
GKQCIVVAIDARRRNDPNNRGWDVYVRGGRENTGLDAIEWAKEVEKRGAGELLVTSMDAD
GTQAGYDLELTRTIAEQVEIPVIASGGAGNCHHIYESLTQGKAEAALLASLLHYGQLTIP
EVKNYLGDRQVPVRVR
Download sequence
Identical sequences B7JXL4
395962.Cyan8802_0714 41431.PCC8801_0686 gi|257058600|ref|YP_003136488.1| WP_012594047.1.62203 WP_012594047.1.93053 gi|218245556|ref|YP_002370927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]