SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058677|ref|YP_003136565.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058677|ref|YP_003136565.1|
Domain Number 1 Region: 169-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.94e-61
Family Methylesterase CheB, C-terminal domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.71e-26
Family CheY-related 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058677|ref|YP_003136565.1|
Sequence length 367
Comment response regulator receiver modulated CheB methylesterase [Cyanothece sp. PCC 8802]
Sequence
MIKVLLVEDSPVALTLLKRMLTSNDQTEVVGTARTGIEALELIPKVNPDVICTDIYMPQM
DGLEFTSQVMAKYPRPILVISAGVQNKDTQEVFAILDAGAVDVFPKPAGGLGVDYEVTKK
QLINKIKVLSGIKVFTKIRRTTASIMLTKSSISTPETRLSSVVSSSDPDKIRVVAIAAST
GGPHAFQEIFSSLTPNFPVPILCVQHISEGFLQGFLNWLKTVCSLRVEIAEHQQVPQPGK
IYFPPEHRHLQIDAQGRFNCTLSPPVDGHCPSATALFESVAQFYGKESVGILLTGMGRDG
ARGLLKIAQAGGLTIAQDESTSVVFGMPQEAIKLGATKTVLPIQEIAPLLINKLMINTKV
IAKKPGN
Download sequence
Identical sequences B7JYH7
395962.Cyan8802_0791 41431.PCC8801_0765 WP_012594123.1.62203 WP_012594123.1.93053 gi|218245632|ref|YP_002371003.1| gi|257058677|ref|YP_003136565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]