SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058706|ref|YP_003136594.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257058706|ref|YP_003136594.1|
Domain Number - Region: 6-57
Classification Level Classification E-value
Superfamily MetI-like 0.0523
Family MetI-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058706|ref|YP_003136594.1|
Sequence length 65
Comment hypothetical protein Cyan8802_0821 [Cyanothece sp. PCC 8802]
Sequence
MSKSTRFVLSSFAIPFIISLVITLTVYILRGMRILGFLPGGVVLILIAVSIILGILYTRQ
ATRRF
Download sequence
Identical sequences 395962.Cyan8802_0821 WP_015783336.1.62203 gi|257058706|ref|YP_003136594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]