SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058728|ref|YP_003136616.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058728|ref|YP_003136616.1|
Domain Number 1 Region: 251-413
Classification Level Classification E-value
Superfamily CinA-like 1.96e-53
Family CinA-like 0.00011
Further Details:      
 
Domain Number 2 Region: 1-203
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 2.49e-39
Family MoeA central domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058728|ref|YP_003136616.1|
Sequence length 416
Comment competence/damage-inducible protein CinA [Cyanothece sp. PCC 8802]
Sequence
MSAEIICVGTELLLGDILNSNSQFLAKELARLGIPHYYQTVVGDNPSRLKQVIEIASNRA
SILIFTGGLGPTPDDLTTETIADFFNTPLVERPEIIEDMSRKFAARGRTMTDNNRKQALL
PQGADILANPLGTAPGLLWQPRPNLTLMTFPGVPSEMKRMWQETAIPYLKNQGWGKEIIF
SRMLRFRGIGESALAAKVSRFFDLTNPTVAPYASLGEVRLRVSAKTRSEQEAIALIDPVA
QELQKIAGLDYYGSDDETLASVVGSVLRQKGETVSVAESCTAGGLGSVLTSVAGSSDYFR
GGIIAYDNSVKVDLLGVNPADLEQYGAVSDIVAQQMALGVKQRLGTDWGVSITGVAGPGG
GTDTKPVGLVYVGLADSQGQVESFECRFGTERDREMVRSLSAYTALDHLRRKLLVR
Download sequence
Identical sequences 395962.Cyan8802_0843 gi|257058728|ref|YP_003136616.1| WP_015783347.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]