SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058759|ref|YP_003136647.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058759|ref|YP_003136647.1|
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.000000000068
Family Subunit XII of photosystem I reaction centre, PsaM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058759|ref|YP_003136647.1|
Sequence length 31
Comment photosystem I reaction center subunit XII [Cyanothece sp. PCC 8802]
Sequence
MALSDTQIIVALIIALLPGFLAFRLATELYK
Download sequence
Identical sequences B7JYQ9
WP_012594204.1.62203 WP_012594204.1.93053 gi|257058759|ref|YP_003136647.1| gi|218245714|ref|YP_002371085.1| 395962.Cyan8802_0876 41431.PCC8801_0849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]