SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058810|ref|YP_003136698.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058810|ref|YP_003136698.1|
Domain Number 1 Region: 389-589
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.74e-68
Family Pyruvate oxidase and decarboxylase PP module 0.00000834
Further Details:      
 
Domain Number 2 Region: 206-381
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.76e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000366
Further Details:      
 
Domain Number 3 Region: 16-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.43e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058810|ref|YP_003136698.1|
Sequence length 619
Comment acetolactate synthase 3 catalytic subunit [Cyanothece sp. PCC 8802]
Sequence
MVSSIEKITSSLPATPQRRTGAFALMDSLVRHGVKHIFGYPGGAILPIYDELYRSEARGE
LQHFLVRHEQAAAHAADGYARATGKVGVCFGTSGPGATNLVTGIATAHMDSIPMVIITGQ
VGRSAIGSDAFQETDIFGITLPLVKHSYVVRQAQDMARIVAEAFHIASTGRPGPVLIDIP
KDVGLEECDYVPVEPGDVNLPGYRPTVKGNPRQINAALHLIEESYRPLLYIGGGAIAANA
HAQVQELAERFQIPVTTTLMGIGAFDEHHPLSVAMLGMHGTAYANFAVSECDLLIAVGAR
FDDRVTGKLDEFASHAKVIHIDIDPAEVGKNRTPDVPIVGDVRRVLEQLLQRAREIDCPT
HAEKTQPWLSRINRWREQYPLVIPHYDHSISPQEVIAEVGRQAPHAYYSTDVGQHQMWAA
QFLNNGPRRWISSGGLGTMGYGMPAALGAKVAVPDQEVICISGDASFQMNLQELATLAQY
GINVKTVIVNNGWQGMVRQWQQAFYGERYSSSNMQAGMPDFELLAQAFGVKGITVREHSE
LSGAIAEMLAHQGPVLMDVHVTRDENCYPMVAPGKSNAQMIGLPERKSLGEAIELIYCTH
CGAKNPTTNHFCPECGTKL
Download sequence
Identical sequences WP_015783386.1.62203 395962.Cyan8802_0929 gi|257058810|ref|YP_003136698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]