SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058854|ref|YP_003136742.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058854|ref|YP_003136742.1|
Domain Number 1 Region: 219-461
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.66e-72
Family Leukotriene A4 hydrolase catalytic domain 0.00073
Further Details:      
 
Domain Number 2 Region: 20-212
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.75e-48
Family Leukotriene A4 hydrolase N-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 552-838
Classification Level Classification E-value
Superfamily ARM repeat 6.53e-23
Family PBS lyase HEAT-like repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058854|ref|YP_003136742.1|
Sequence length 857
Comment peptidase M1 membrane alanine aminopeptidase [Cyanothece sp. PCC 8802]
Sequence
MSSQKFDTEDNNRKFELPGAKPNYNPDRPGQVNHIFLDLVIDIPNQCFSGTCTITLTPVR
SGITQLTLDAVNLDIHSVLIDNISQPFDYDRQKLMVHLLKSTKTEPINIAIAYQVNQPKR
GLYFVSPNQHYPDKPTQVWTQGEDEDSRFWFPCFDYPGQLATSEIRVKVPQQYTVISNGE
LIDTQTVGETKIYHWSQQQIHPTYLMTLAVGEFSKISDTCQGIPVNYYVEKGREEQAKLS
MGKTPRMIEFFASKFGYPYPYPQYDQVCVDDFIFGGMENTSTTLLTDRCLLDERAAIDNQ
RTESLVAHELAHQWFGDLVVIKHWSHAWIKEGMASYAEVLWVEQEEGKDDAAYYLLGEAR
NYLEEDSSRYRRPIVTHIYREAIELYDRHLYEKGACVYQMIRSLLGDELFDQAIHTFVKD
NAHKTVETIDLLRAIEKATGYNLLSLFDQYVFRGGHPDYQVTYSWDGDSNLAKLTVTQKQ
VKDKKNGDQADLFDLKIPVAFGYINQANSSKPFTLRIHEKQQSFYFPLEKKPDFISFDVS
NTFLKTVELEYPIPELKAQLKHDPDPISRIYAAIAIAKKGGLEAVEALGESLTQDPFWGV
RVEAAKQLGKVKLDQAGEALIKGLADDNAKVRRSVVESLSEIKTLSCYETLKSCLEKGDV
SYYVEAATARSLGAILSGNLKQKEGEVIELLKQVLDTRSGWNEVVRSGAIGGLSQLKTSA
TAAEIISQYTKLGTPQPLRLAAIRALGTVSTGQTPDKLTEILEQLEGISLEDFFLTQVAI
TGALGQMETPKAISILQSLAERTPDGRVRRSAEEAIKKVQKKLGSDQGIKALREEVEKLQ
QENQDLKSRLAKLEAKN
Download sequence
Identical sequences 395962.Cyan8802_0973 gi|257058854|ref|YP_003136742.1| WP_015783406.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]