SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058855|ref|YP_003136743.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058855|ref|YP_003136743.1|
Domain Number 1 Region: 28-199
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.75e-35
Family TehB-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058855|ref|YP_003136743.1|
Sequence length 225
Comment type 11 methyltransferase [Cyanothece sp. PCC 8802]
Sequence
MNEEHRKNLMQNVKKLASEAQEDGDPTAWFEKLYLDANGDISKIPWAKMTPHPALEDWLI
QTNFTYKNALVIGCGLGDDAEKLASIGASVTAFDISPRAISWCNTRFSHSSVNYVVADLL
TLESRWKQSFDFVFESRTIQALPIDIRNKVINAVANLVSPGGTLLIVTRLRDTEDIPEGP
PWAVSELELSQFHQLGFQEVSRTPYIDANQPTIKQASIEYQSVVL
Download sequence
Identical sequences B7JZT1
WP_012594299.1.62203 WP_012594299.1.93053 395962.Cyan8802_0974 41431.PCC8801_0947 gi|257058855|ref|YP_003136743.1| gi|218245809|ref|YP_002371180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]