SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058934|ref|YP_003136822.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257058934|ref|YP_003136822.1|
Domain Number - Region: 202-234
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000286
Family Rho termination factor, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 41-90
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.0942
Family ParB-like nuclease domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058934|ref|YP_003136822.1|
Sequence length 241
Comment hypothetical protein Cyan8802_1055 [Cyanothece sp. PCC 8802]
Sequence
MSNLTDIGNLMYLYLDSIDPGTKSNAHQFLINAAATILAKNGGHNWVPVIVKETQEDHYQ
IIGNSFIYEVVKAAGLERVWCIIAEASPEAEEISQVLAGETIPKINLCTASREDIKYGLE
YLMQQPGSSIKSINLSVATNKIDESDRQYWKSFDPITKLKCGLTKGNKLDTLKNIFYLEP
ITKPIEEPITKPAIETPQKPTKNLKTLTVQKLKALAKQQGLSGYSKLKKDELIKLLNLSS
I
Download sequence
Identical sequences gi|257058934|ref|YP_003136822.1| 395962.Cyan8802_1055 WP_015783439.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]