SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058936|ref|YP_003136824.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058936|ref|YP_003136824.1|
Domain Number 1 Region: 245-500
Classification Level Classification E-value
Superfamily HemD-like 4.19e-71
Family HemD-like 0.0038
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 4.19e-61
Family Tetrapyrrole methylase 0.00000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058936|ref|YP_003136824.1|
Sequence length 505
Comment uroporphyrin-III C-methyltransferase [Cyanothece sp. PCC 8802]
Sequence
MRLGKVYLVGAGVGNIAYLTVRGHQLLTQAEVLIYDALVESDLLTLVPETCLKLNVGKRG
GLPSTDQRTINQLLVAYCLQGKQVVRLKSGDPLIFGRINPEIEALQQANCSYELVPGVSS
ALAAPLFAGIPLTDKELSRCFAVVSGHEPDLLDWKALSKLDTLVILMAGKTLGEIVAKLQ
EEGRSHSEPIAIIRHGGSSQQQVWISTLGDIVDQIAGVALSPAIMVIGEVVNLRMIDASS
RPLDGQTVLVTRAAEQSSQFTLMLQQEGAKVIEMPALEILPPSSWQELDTAISQLSSFDW
LILTSANGVKFFFERLYHLGHDVRALGGIKLAVVGKKTDSVLKNYGLKADFIPPNFVADS
LVETFPESLTNKKVLFPRVETGGRDLLVQELQKQSAQVIEVPAYQSGCPSKIDPEVWQAL
QQKTVNIITFASSKTVQNFYQLIKQELGANYLELIPAMLDQVCLASIGPQTSKTCYELFG
RVDIEATEYTLEGLTDALIKKQLIL
Download sequence
Identical sequences 395962.Cyan8802_1057 gi|257058936|ref|YP_003136824.1| WP_015783441.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]