SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059008|ref|YP_003136896.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257059008|ref|YP_003136896.1|
Domain Number - Region: 34-140
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 0.00425
Family CTP-dependent riboflavin kinase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059008|ref|YP_003136896.1|
Sequence length 155
Comment hypothetical protein Cyan8802_1131 [Cyanothece sp. PCC 8802]
Sequence
MNKQWIKVKGIVKAGYQVASGRNKNSPYPQGSIAMQKDFFRALGLDISGYFLGTLNVTIS
PHRFILKHPEYTFKKVKWNPHSIAEDFSFSECCVTFQGIEYKGLIYYPHPETKPDHFQDD
STLEILAPPIVNINYGDALELAVNSQEIEIFSQQI
Download sequence
Identical sequences gi|257059008|ref|YP_003136896.1| 395962.Cyan8802_1131 WP_015783482.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]