SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059125|ref|YP_003137013.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059125|ref|YP_003137013.1|
Domain Number 1 Region: 86-142
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000136
Family GSPII protein E N-terminal domain-like 0.039
Further Details:      
 
Domain Number 2 Region: 22-69
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000251
Family GSPII protein E N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059125|ref|YP_003137013.1|
Sequence length 191
Comment hypothetical protein Cyan8802_1255 [Cyanothece sp. PCC 8802]
Sequence
MKKSLPNLIISEPHIVIPKDYWSPRLGEILLEADLITPQQLTRALNDQAKYPDLCLGEIL
VIRGWLKQRTADFFATKWSNYLKQERKYRLGEYLKKAALLDERKIEQILAEQRRLGLKFG
AVAVLNGWINPGTLDFFIEHLFPERQHDSCLTVHQTALRVHKTSTRKPEPSKQPEISVET
WASEAARRVSR
Download sequence
Identical sequences gi|257059125|ref|YP_003137013.1| 395962.Cyan8802_1255 WP_015783544.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]