SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059169|ref|YP_003137057.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059169|ref|YP_003137057.1|
Domain Number 1 Region: 204-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.04e-25
Family RecA protein-like (ATPase-domain) 0.0000389
Further Details:      
 
Domain Number 2 Region: 12-142
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000000022
Family GSPII protein E N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059169|ref|YP_003137057.1|
Sequence length 747
Comment general secretory system protein E [Cyanothece sp. PCC 8802]
Sequence
MSLSNDFDQLSLSPFSNQLIQSGYISLPRMQQALIEARNSRRPFMKILEQITGNPLPPTL
LRQYKEHHLFTLKILHGIEFINPEAEPVDREQMSQLVQQFIPFEICRRYQVLPLKAIDSN
LLVGMVNPSHTEAQEMLTKLLRSHQISWQRVGISQEDYDNFIEQYIPSAINSENEDQGFG
ATLVDSTEIFEDPPETISDLFKDEPDSPVVTLVNKILVTAIEREGTHLEIDPQEDSVIIR
YRQTQADTLQPLFDPLPKKVAAPITSRLKIMANLDISQRKTPQKGRITKARGQRTLHFFV
NTLPSLHGEKVSIRIVDSNVKPLPLETLISDRSLVESLLTMTDHPTGLLLISSANQRMIY
SMLLSLLARKNPQQLNIATLEESISYLLPGVTQIEVDNEGDKDYASVLRSLASQDLDILM
VDHLREPTMARMVVEMSRHCLILTSLIAQDGASALAHLSQMVDQSLLADTLIGGIHHYAI
PRLCPTCLSVHDPSPKELAQFGISPSKKAEISFYQARTLTAEGIAQARERGRLCRTCSGT
GYQGHQAVYEVLRGTPSLKTAIAHGSTLTRLKQTFLPEKSALTTALDLVYQGQASLADVA
TLFPHDLHNTSNPPSVPAKNADLTERLANFEKLLLALTEEFQQLKEAIEANSSSSGEDIN
LTVTPLYESMVQGASLEALEQDIDPSKETIAGDSLLYEELTDPGDWDALKRELQPEQETI
AADFSDLKNSDHRQGLNPFNPVPDPWS
Download sequence
Identical sequences gi|257059169|ref|YP_003137057.1| WP_015783566.1.62203 395962.Cyan8802_1299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]