SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059292|ref|YP_003137180.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059292|ref|YP_003137180.1|
Domain Number 1 Region: 87-513
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.95e-112
Family Amylase, catalytic domain 0.0000000027
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000096
Family E-set domains of sugar-utilizing enzymes 0.00077
Further Details:      
 
Weak hits

Sequence:  gi|257059292|ref|YP_003137180.1|
Domain Number - Region: 527-577
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000115
Family alpha-Amylases, C-terminal beta-sheet domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059292|ref|YP_003137180.1|
Sequence length 605
Comment malto-oligosyltrehalose trehalohydrolase [Cyanothece sp. PCC 8802]
Sequence
MKLSANYDGNSDCQFTLWAPKVRQVDLKIITPTEQIIPMECDEKGYWKTHLKIAPGSLYC
YQLDSEQTRPDPASYSQPKGVHGPSEIIDHHRFNWTDHQWKNLPFTDFVIYELHVGTFTP
EGTLTAIIPRLSQLKAVGITAIELMPLSQFPGDRNWGYDGVYPFAVQQSYGGVDGLKELV
NACHQEGLAVILDVVYNHLGPEGNYTANFAPYFSHKYQTPWGNALNFDDAYSYGVRNFFI
ENALYWLRDYHIDGLRLDAIHGIYDQSAKHFLAELREKVDQLSQQCDRPFYLIAESDLND
GRILRPLEVGGYGMDAQWSDDFHHCLHTLLTGENQGYYQDFGRCDHLTQAFKQSFVYSGD
YSPHRQRYHGGSVSDRPSSQFVVYAQNHDQIGNRMLGERLSNLVSFNALKLAAGTVILSP
FIPLFFMGEEYGEETPFLYFISHTDSNLVEAVRQGRKEEFKSFQWQGEPPDPYALETFKQ
CQLQWHKRDEGKHKILLKFHQKLLRMRRTIPALKNCNQDHLSVKTWENERLICLHRWFPN
SQVFCIMNFNQETITVTIEPPQGNWIKQLDSNDSEWLGKGSTLPESFHLEQTLIIPESSL
IVYQI
Download sequence
Identical sequences WP_015783647.1.62203 395962.Cyan8802_1428 gi|257059292|ref|YP_003137180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]