SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059420|ref|YP_003137308.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059420|ref|YP_003137308.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.66e-59
Family Ribosomal protein S7 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059420|ref|YP_003137308.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Cyanothece sp. PCC 8802]
Sequence
MSRRGNIKRRPVPPDPVYNSRLISMTIRRVMKSGKKSVAAGIMYDALTSIGEKTGSDPLE
VFEKAIKNLTPLVEVKARRVGGATYQVPMEVRSSRGTTLALRWLVHYARIRGGRTMSSKL
ANEIMDAANETGGAMKKRDETHRMAEANKAFAHYRY
Download sequence
Identical sequences B7JUP7
WP_012594864.1.62203 WP_012594864.1.93053 gi|257059420|ref|YP_003137308.1| 395962.Cyan8802_1563 41431.PCC8801_1538 gi|218246376|ref|YP_002371747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]