SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059519|ref|YP_003137407.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059519|ref|YP_003137407.1|
Domain Number 1 Region: 140-359
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.24e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000587
Further Details:      
 
Domain Number 2 Region: 444-592
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.2e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000477
Further Details:      
 
Domain Number 3 Region: 9-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.18e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0045
Further Details:      
 
Domain Number 4 Region: 360-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.39e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.003
Further Details:      
 
Weak hits

Sequence:  gi|257059519|ref|YP_003137407.1|
Domain Number - Region: 598-634
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0116
Family PutA pre-N-terminal region-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059519|ref|YP_003137407.1|
Sequence length 638
Comment sulfite reductase subunit beta [Cyanothece sp. PCC 8802]
Sequence
MVHTPTSPPQKLSKLEGIKENSNFLREPLATEILEETTHFTENAVQILKFHGSYQQDNRD
NRVKGQEKDYQMMLRTRNPGGFIPPQLYLTLDRLSDEYGNQTLRVTTRQGFQLHGILKKN
LKSAIAAIVNSMGSTLGACGDLNRNVMAPPAPFKNRPEYQYAWKYADNIADLLTPQTEAY
YEIWLDGEKFLSAEESPEVVAARQRNSNKTLFPNKEEPIYGVHYMPRKFKCSVTVPGDNS
IDVYTHDVSLVVITDEHGQLQGFNILAGGGMGRTHGKEETFARLSDPLGYVAKEDVYDAM
KAIVATQRDYGDRVQRRHARMKYLLHDWGVEKFRAKVEEYFGKPLEPFKPLPEWKYQDYL
GWNEQGDGKLFLGISVENGRVKDEGSFRLKTALKSIIEQFELPMRLTANHNIILYEIEPS
QKAAIEGTLHDCGIITNPQEVESLTRYSMACPALPTCGLAITESERALPGIIGRIKQVLT
KVGLEDEEIVIRMTGCPNGCARPYMAELGFVGNAPNSYQIWLGGSPNQTNLAQPYTDKLP
DKDIEKFLEPLFAYFKQERTVQESFGQFCHRVGFEALRAFSEGYQPIKVRRIRKNQHRVS
VPDEMFTRLKEASEGEKRPMNHIVQEALEAYFSQKQSN
Download sequence
Identical sequences gi|257059519|ref|YP_003137407.1| 395962.Cyan8802_1667 WP_015783761.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]