SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059527|ref|YP_003137415.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059527|ref|YP_003137415.1|
Domain Number 1 Region: 399-715
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 3.27e-104
Family Hypothetical protein PH1602 0.0000731
Further Details:      
 
Domain Number 2 Region: 77-186,352-398
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.4e-29
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.09
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 3.27e-18
Family Hypothetical protein PH1602 0.0025
Further Details:      
 
Domain Number 4 Region: 174-244
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000365
Family Intron-encoded homing endonucleases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059527|ref|YP_003137415.1|
Sequence length 715
Comment hypothetical protein Cyan8802_1675 [Cyanothece sp. PCC 8802]
Sequence
MPYEPLKLSTPTPVLSWANHRLGLEETQMAKNMASLPFVFKHIALMPDVHLGKGALVGSV
IATKDAVIPAAVGVDIGCFTGDTLIPLIDGKSYPLRELADSGKPIYVYSCTKTGKIVATE
AIARLTRQNAPLVKVILDNGVEIKCTPDHPFMLRDGEYQEASQLRKGTSLMPFYSKVDRD
GYTLIQQNYSGRWQKAHWIIARSGLLGKVPKFENQRTVIHHKNFNQADNSLDNLEFMGNR
DHSAYHGSFVDRNTHWQSPEFEKQKKDALAAKSKTSEGYQYYAERGTRNILQYMQNNPEH
FQQSVSGNGERGKQYLVHYNQSPKGRAKSKEIANRFYTCEICGEQVKSSIGLHNHRKYQH
TYNHKVVDIIFLNESQDVYCLSVPEYHNFALSAGVFVHNCGMAALKMPFTADQLEGKLKQ
IRLEIEAAIPVGFEENKDAEKAVTNWQGWREFKELHRGVKDLETKAIRQLGSLGGGNHFI
ELCLDTDDQVWLMLHSGSRHIGNKLAECHISTAKNLAKLAQISLPDPDLSYFVAGTPEFA
AYWHDLQWAQEYAKFNRDVMMNRFKKIVEKHLAGGKPTKPLLSVNCHHNYAEKEVHFGEE
VYVTRKGAVRARTEDYGIIPGSMGAKSFIVKGKGSHESYCSCSHGAGRLMSRSKAKKQFS
IDDLVAQTQGVECRKDSGVLDEIPGAYKPIDQVMENQADLVEVVATLKQVLCVKG
Download sequence
Identical sequences gi|257059527|ref|YP_003137415.1| 395962.Cyan8802_1675 WP_015783766.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]