SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059539|ref|YP_003137427.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059539|ref|YP_003137427.1|
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 7.33e-19
Family Ribosomal protein L33p 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059539|ref|YP_003137427.1|
Sequence length 64
Comment 50S ribosomal protein L33 [Cyanothece sp. PCC 8802]
Sequence
MAAKKGVRIIITLECTECRTNTDKRSPGVSRYTTSKNRRNTTGRMEIKKFCPHCNTHTIH
KEIK
Download sequence
Identical sequences B7JW32
395962.Cyan8802_1688 41431.PCC8801_1670 gi|257059539|ref|YP_003137427.1| WP_012594994.1.62203 WP_012594994.1.93053 gi|218246506|ref|YP_002371877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]